KEGG   Dickeya dadantii Ech703: Dd703_1970Help
Entry
Dd703_1970        CDS       T00927                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
dda  Dickeya dadantii Ech703
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Dd703_1970
Enzymes [BR:dda01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Dd703_1970
    3.5.1.-  
     Dd703_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2341823..2342461
Genome map
AA seq 212 aa AA seqDB search
MNKALLLIDVQNDFCPGGALAVADGDRVVDVANLAIDAAIKANITVIASQDWHPANHRSF
AVNSGTEIGAMGDLDGLTQIWWPVHCVQNQPGAEFHPRLNQNAIEWVVRKGVQPDIDSYS
AFFDNGHRASTGLHDWLHRRRITQLTIIGLATDYCVKYTVLDALELGYQTEVLVDGCRGV
NLHPNDSQNALNEMSQRGATLIDLAHFINAPA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggctctgctccttattgatgtgcaaaacgacttctgccccggcggcgcactc
gccgtcgccgacggcgatcgcgtggtcgacgttgcaaatctggcgatagacgccgcgata
aaagccaatatcaccgtgattgccagccaggactggcatccggcgaatcatcgcagtttt
gccgtgaactcaggaacggagatcggagcaatgggcgatctcgacgggttaacgcaaatt
tggtggccggttcactgtgttcaaaaccaacctggcgcggagtttcatccccgactgaac
caaaatgcgattgaatgggtagtgcgtaaaggggttcagcctgatatcgacagctacagc
gcctttttcgacaacggccaccgcgccagtaccggcttgcacgactggctccatcgccgc
cgcatcacccaattaaccatcatcgggctggcgacagattactgtgtcaaatataccgta
ctggatgctctggaattgggttatcaaaccgaggtactggtcgatggttgtcgcggcgtc
aatctgcacccaaacgacagccagaacgcgctgaacgagatgtcgcaacgtggcgctacg
ctgattgatttggcgcatttcatcaatgcccccgcctga

DBGET integrated database retrieval system