KEGG   Dickeya dadantii Ech703: Dd703_2155Help
Entry
Dd703_2155        CDS       T00927                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd703_2155
   01230 Biosynthesis of amino acids
    Dd703_2155
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_2155
   00051 Fructose and mannose metabolism
    Dd703_2155
   00562 Inositol phosphate metabolism
    Dd703_2155
Enzymes [BR:dda01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dd703_2155
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dd703_2155
  Exosomal proteins of bladder cancer cells
   Dd703_2155
  Exosomal proteins of melanoma cells
   Dd703_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2542998..2543783
Genome map
AA seq 261 aa AA seqDB search
MRNLMLGTSWKMNKTLEEANAYCDVLVNRLNAAAGPHIQPFVIPPFTLIREVTTRLRQGG
VNCLTGAQNMHYADAGAWTGEISPAMVRDCGATLVELGHSERRRDFAENDADIQKKVQAA
LRYQLRPLVCVGDSAQEKGWGVSIETVVRQMKIALAGLARPQVEQVIIAYEPVWAIGDGG
TPATADEAQTIHRALRQALADTYGPDTAENVTLLYGGSVNPHNSSALIQCPDIDGLFIGR
SAWDAEGFCRLAHNAATWRER
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacctgatgctgggcaccagttggaaaatgaacaaaaccctggaagaggccaac
gcctattgcgatgtgttggttaatcggctcaatgcggcggccggcccccacatccagcca
ttcgtcatccccccttttaccctgattcgtgaggtgacgacgcgcttgcgtcagggcggc
gtcaactgcctgaccggcgcccagaacatgcactatgccgatgccggcgcctggaccggg
gaaatctcaccggccatggtgcgcgactgcggtgcgacgctggtggagctgggccattcg
gaacggcggcgcgactttgccgaaaatgacgcggatattcagaaaaaagtacaggccgcg
ctacgctatcagctacggccgctggtgtgcgtcggtgacagcgcgcaggaaaaaggctgg
ggggtctcgattgaaaccgtcgtgcgtcagatgaaaatcgccctggccgggctggcgcgc
ccgcaggttgaacaggtgatcatcgcgtatgaacccgtgtgggcgatcggcgacggcggc
accccggcgacggccgatgaagcgcaaaccatacaccgcgccctgcggcaggcgctggcg
gatacctacggcccggacacggcggaaaacgtgacgttgctgtacggtggcagcgtaaat
ccgcataatagttcggcgctgatccaatgccctgatatcgatggattattcatcggccgc
tcggcatgggacgctgagggtttttgtcgattggcgcacaacgccgcgacgtggcgggaa
cgttaa

DBGET integrated database retrieval system