KEGG   Dickeya paradisiaca: Dd703_2155Help
Entry
Dd703_2155        CDS       T00927                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dda  Dickeya paradisiaca
Pathway
dda00010  Glycolysis / Gluconeogenesis
dda00051  Fructose and mannose metabolism
dda00562  Inositol phosphate metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
dda01230  Biosynthesis of amino acids
Module
dda_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dda_M00002  Glycolysis, core module involving three-carbon compounds
dda_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_2155
   00051 Fructose and mannose metabolism
    Dd703_2155
   00562 Inositol phosphate metabolism
    Dd703_2155
Enzymes [BR:dda01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dd703_2155
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dd703_2155
  Exosomal proteins of bladder cancer cells
   Dd703_2155
  Exosomal proteins of melanoma cells
   Dd703_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACS85942
JGI: Dd703_2155
UniProt: C6C748
Position
2542998..2543783
Genome map
AA seq 261 aa AA seqDB search
MRNLMLGTSWKMNKTLEEANAYCDVLVNRLNAAAGPHIQPFVIPPFTLIREVTTRLRQGG
VNCLTGAQNMHYADAGAWTGEISPAMVRDCGATLVELGHSERRRDFAENDADIQKKVQAA
LRYQLRPLVCVGDSAQEKGWGVSIETVVRQMKIALAGLARPQVEQVIIAYEPVWAIGDGG
TPATADEAQTIHRALRQALADTYGPDTAENVTLLYGGSVNPHNSSALIQCPDIDGLFIGR
SAWDAEGFCRLAHNAATWRER
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacctgatgctgggcaccagttggaaaatgaacaaaaccctggaagaggccaac
gcctattgcgatgtgttggttaatcggctcaatgcggcggccggcccccacatccagcca
ttcgtcatccccccttttaccctgattcgtgaggtgacgacgcgcttgcgtcagggcggc
gtcaactgcctgaccggcgcccagaacatgcactatgccgatgccggcgcctggaccggg
gaaatctcaccggccatggtgcgcgactgcggtgcgacgctggtggagctgggccattcg
gaacggcggcgcgactttgccgaaaatgacgcggatattcagaaaaaagtacaggccgcg
ctacgctatcagctacggccgctggtgtgcgtcggtgacagcgcgcaggaaaaaggctgg
ggggtctcgattgaaaccgtcgtgcgtcagatgaaaatcgccctggccgggctggcgcgc
ccgcaggttgaacaggtgatcatcgcgtatgaacccgtgtgggcgatcggcgacggcggc
accccggcgacggccgatgaagcgcaaaccatacaccgcgccctgcggcaggcgctggcg
gatacctacggcccggacacggcggaaaacgtgacgttgctgtacggtggcagcgtaaat
ccgcataatagttcggcgctgatccaatgccctgatatcgatggattattcatcggccgc
tcggcatgggacgctgagggtttttgtcgattggcgcacaacgccgcgacgtggcgggaa
cgttaa

DBGET integrated database retrieval system