KEGG   Dickeya dadantii Ech703: Dd703_2211Help
Entry
Dd703_2211        CDS       T00927                                 

Gene name
sbcB
Definition
exonuclease I (EC:3.1.11.1)
Orthology
K01141  
exodeoxyribonuclease I [EC:3.1.11.1]
Organism
dda  Dickeya dadantii Ech703
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:dda03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2605607..2607037
Genome map
AA seq 476 aa AA seqDB search
MRNSQTESTFFIHDYETFGKHPAKDRPAQFAGIRTDQDFNVIGEPVVIYCQPADDYLPDP
EAVMITGITPQLASSKGIGEVDFARQIHDAFSTPGTCIMGYNNIRFDDEVSRNLFYRNFI
DPYAYSWQNGNSRWDLLDALRACYALRPEGIVWPENEEGFPSFRLEHLTRANGIEHEHAH
DAMSDVYATIAMARLFKQTQPRLFDYLYQLRNKNKVNALIDIAEMKPLVHVSGMFGAARG
NTSWIVPLAWHPENRNAVIVCDLAGDIDPLLNLSADALRTRLYTRRDLLGENESPVPIKL
VHINKCPVLAPAATLRPEDAARLGVDRQRCLDNLKLLRQHPLVREKVVALFADAPAFEPA
ADVDLQLYDGFFGDADRAAMTIIRETAPQHLPALKLQFADRRMEELLFRYRARNFPGTLD
DQEQQRWLRHRREIFTPERLQSYSETLESLYQIHADDEKKIALLKALFTYAQQLVA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaattcacaaaccgaatccaccttttttattcacgattacgagactttcggcaag
cacccggccaaagatcggcccgcccagtttgccggtattcgcaccgaccaggatttcaac
gtcatcggcgaaccggtggtgatctactgtcagcccgccgacgattatctgccagacccc
gaagccgtgatgattaccggcattacaccgcaactggcgagcagcaaagggatcggcgag
gtcgacttcgcccgtcaaattcatgatgcattcagcacgcccggcacctgcatcatgggt
tacaacaatattcgcttcgacgacgaagtcagtcgcaatctgttttatcgcaatttcatc
gacccttacgcctacagctggcaaaacggtaattcacgctgggatttgctggatgcgctg
cgcgcctgctatgcgctgcggccggaaggcatcgtctggccggaaaatgaggaaggattc
cccagcttccggttggagcacctgacgcgcgccaacggcatcgagcacgaacacgcccac
gacgccatgtcggacgtttatgccaccattgctatggcgcgcctgttcaaacagacgcaa
ccccggttgtttgattatctgtatcagctacgcaacaagaacaaggtcaacgcgctgatc
gacatcgcggaaatgaaaccgctggtgcacgtatccggtatgttcggcgcggcgcgcggc
aataccagttggattgtgccgttggcctggcatccggaaaaccgcaatgccgtcatcgtc
tgtgatctggcgggcgatatcgacccgttgctgaacctgagcgccgatgcgctgagaacc
cgcttgtatactcgccgcgatctgctgggcgaaaacgaatcgccggtaccgatcaaactg
gtgcatatcaacaaatgcccggtgctggcccccgccgccacgctacgacctgaagatgcg
gcgcggctgggcgtcgatcgtcagcgctgccttgataacctgaaactgctgcgtcaacac
ccgctagtcagagaaaaagtggtggcgttgtttgccgacgcacccgcgttcgagcccgcc
gccgatgtggacttgcagttatacgatggtttcttcggcgacgccgatcgggcggcgatg
accatcattcgcgaaacggcgccccagcacctgcccgcgctgaagctgcaattcgccgat
cgccgaatggaagaactgctgtttcgctaccgggcgcgcaatttccccggcacgctggac
gatcaggaacaacagcgctggctgcggcatcgccgcgagatctttacgccggaacggctg
caatcctattcggagacgctggaaagcctgtatcagatccatgccgatgacgagaagaaa
attgcgctgcttaaggcgctgttcacttacgcccaacaactggtggcctga

DBGET integrated database retrieval system