KEGG   Dickeya dadantii Ech703: Dd703_2306Help
Entry
Dd703_2306        CDS       T00927                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dda  Dickeya dadantii Ech703
Pathway
dda00790  Folate biosynthesis
dda01100  Metabolic pathways
Module
dda_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dd703_2306
Enzymes [BR:dda01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dd703_2306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACS86090
JGI: Dd703_2306
UniProt: C6C8C4
Position
complement(2714064..2714732)
Genome map
AA seq 222 aa AA seqDB search
MSSILSKEAAQVHEALLARGLETPLRGELQDAETRKRLIAQHMTEIMNLLSLDLSDDSLA
ETPHRIAKMYVDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGK
ATVAYIPKEGVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHY
CVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHSY
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatattgtcaaaagaagcagcccaggttcatgaggcgctgctggcgcgtggt
ctggagaccccgttgcgcggcgaattacaggatgcggaaactcgcaaacgcctgattgcg
cagcatatgaccgaaatcatgaatctgttgagccttgatttgagtgacgacagtttggcg
gaaacgccgcaccgcatcgccaaaatgtatgtggatgaaatcttctccgggctggattac
gccaacttccccaaaatcaccattatcgaaaacaagatgaaggtcgatgaaatggtgacg
gtacgcgatatcacgctgaccagcacctgtgagcaccattttgtgaccatcgacggcaaa
gccacggtggcctatatccccaaagagggcgtgattggtctgtccaagatcaaccgcatt
gttcagtttttctcgcagcggccgcaggtgcaggagcgtttgacgcagcagattctggtg
gcgttgcaaaccctgctgggtaccaataacgtggcggtctccatcgacgcggtgcactat
tgcgtcaaggcgcgcggtattcgcgatgcgaccagcgcgactaccacgacgtcgctcggc
ggcctgttcaaatccagccagaatacccgccaggaattcctgcgcgcggtgcgccatcac
agctactga

DBGET integrated database retrieval system