KEGG   Dickeya dadantii Ech703: Dd703_2306Help
Entry
Dd703_2306        CDS       T00927                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dda  Dickeya dadantii Ech703
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dda00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2714064..2714732)
Genome map
AA seq 222 aa AA seqDB search
MSSILSKEAAQVHEALLARGLETPLRGELQDAETRKRLIAQHMTEIMNLLSLDLSDDSLA
ETPHRIAKMYVDEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGK
ATVAYIPKEGVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHY
CVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHSY
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatattgtcaaaagaagcagcccaggttcatgaggcgctgctggcgcgtggt
ctggagaccccgttgcgcggcgaattacaggatgcggaaactcgcaaacgcctgattgcg
cagcatatgaccgaaatcatgaatctgttgagccttgatttgagtgacgacagtttggcg
gaaacgccgcaccgcatcgccaaaatgtatgtggatgaaatcttctccgggctggattac
gccaacttccccaaaatcaccattatcgaaaacaagatgaaggtcgatgaaatggtgacg
gtacgcgatatcacgctgaccagcacctgtgagcaccattttgtgaccatcgacggcaaa
gccacggtggcctatatccccaaagagggcgtgattggtctgtccaagatcaaccgcatt
gttcagtttttctcgcagcggccgcaggtgcaggagcgtttgacgcagcagattctggtg
gcgttgcaaaccctgctgggtaccaataacgtggcggtctccatcgacgcggtgcactat
tgcgtcaaggcgcgcggtattcgcgatgcgaccagcgcgactaccacgacgtcgctcggc
ggcctgttcaaatccagccagaatacccgccaggaattcctgcgcgcggtgcgccatcac
agctactga

DBGET integrated database retrieval system