KEGG   Dickeya dadantii Ech703: Dd703_2766Help
Entry
Dd703_2766        CDS       T00927                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dda  Dickeya dadantii Ech703
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd703_2766
   00500 Starch and sucrose metabolism
    Dd703_2766
Enzymes [BR:dda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Dd703_2766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3229805..3230905
Genome map
AA seq 366 aa AA seqDB search
MLKTISGSLALTLLLAASLQNAQAADAYNALVSTSSSDSSAFKTIAEAVASAPSGSSSFV
IYIKNGVYKERLTISRDNVHLKGQSRDGTIIAATTAAGTLKSDGTKWGTSGSSTVKVNAK
DFTAEALTIRNDFDFPANQAKSDSDSTKIKDTQAVALYVAGNSDRAYFKNVSLVSYQDTL
YVSGGRSFFSGCRISGTVDFIFGNGTALFDDCDLVSRNRTDVASGGVYGYLTAPSTDINT
TYGLVITNSRVIKESSSVPSKSYALGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHI
YGWDKMSGKDKDGNTIWFYPEDSRFYEYKSTGNGAAVTSSRRQLTSTEAAQYTKSKVLNG
WTPTLP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaccatatcgggatcactggcgctcacgctgttgctcgccgccagtttacag
aatgctcaggcagcggatgcctacaatgccctcgtttcgacatcctccagcgatagttct
gcgtttaaaaccatcgctgaagccgttgccagtgcgccatcgggcagctcttcatttgtg
atttatattaaaaatggcgtgtacaaagaacgtctaaccattagccgggacaatgtgcac
cttaaaggccaaagccgcgacggcaccatcattgcggccacgacggcggcgggaacgctc
aaatcggatggcaccaagtggggcacctccggtagcagtaccgttaaagtcaacgccaag
gatttcaccgcagaagccctgactatccgcaatgactttgacttccccgctaaccaggcc
aaaagcgatagcgacagcactaagataaaggatacgcaggcagtagcgctttacgttgcc
ggcaacagtgatcgcgcctacttcaaaaacgtcagcctggtcagttatcaggacacgctg
tacgtttccggcggccgcagcttcttctccggctgccgcattagcggcaccgtggatttt
atcttcggcaatggtaccgccctgtttgacgattgcgatctggtatcccgtaaccgtacc
gatgtcgcaagcggcggcgtctacggctatctcaccgcgcccagcaccgatatcaacacc
acctatggcctcgtcattaccaacagccgggttatcaaggaaagcagcagcgtaccgtca
aaaagctatgcgttgggacgcccatggcacccgacgaccaccttctcggacggccgttat
gccgacccgaatgctatcggccaaactgtattcctgaacaccagtatggataaccatatc
tacggctgggacaagatgtccggcaaggataaagacggcaataccatctggttctatccg
gaagactcacgcttctacgaatacaaatccacgggtaatggcgcagcagttacttcatca
cgtcgccagctaaccagcacggaagccgctcagtacaccaagagcaaagtgctgaacggt
tggacgccaaccctgccttga

DBGET integrated database retrieval system