KEGG   Dickeya paradisiaca: Dd703_2822Help
Entry
Dd703_2822        CDS       T00927                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dda  Dickeya paradisiaca
Pathway
dda00790  Folate biosynthesis
dda01100  Metabolic pathways
Module
dda_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dd703_2822
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Dd703_2822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACS86599
JGI: Dd703_2822
UniProt: C6CB71
Position
3299405..3299899
Genome map
AA seq 164 aa AA seqDB search
MTRVYLALGSNLAQPLHQVESALQALGAIAETRLVRCSSFYRSRPLGPQDQPDYLNAVAE
LDTGLAPEALLDHTQRIEQQQGRVRKESRWGPRTLDLDILLFGEQIIQTERLTVPHYDMK
NREFMLYPLAELAPDLVFPDGERLSERLRLVPRNGLTAWDTKTE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgtctatctggcgctgggcagtaaccttgcccagccgctacaccaggtggaa
tccgccctgcaggcgttgggggcgattgcggaaacccggttggtgcgctgctcgtcgttt
tatcgcagccgcccgctggggccgcaagatcaacctgattacctgaatgcggtggcggaa
ctggacacaggtctggcaccggaagccttgctggaccatacccaacgtatcgagcagcaa
caagggcgggttcgcaaagaaagtcgttggggaccacgcacgctcgacctggatattctg
ctgttcggcgaacagattattcagaccgagcgcctgacagtgccgcattacgacatgaaa
aatcgtgagtttatgctttatcccctggcggaactggcgcctgatctggttttccctgat
ggtgaacgtcttagcgagcggttgcgtctggttccgcgcaacgggttgaccgcctgggac
acaaaaacagagtaa

DBGET integrated database retrieval system