KEGG   Dickeya dadantii Ech703: Dd703_3006Help
Entry
Dd703_3006        CDS       T00927                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dda  Dickeya dadantii Ech703
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dda00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd703_3006 (recD)
Enzymes [BR:dda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dd703_3006 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3496810..3498660)
Genome map
AA seq 616 aa AA seqDB search
MLELLLEAQRRHLLRPLDVQFAHMLAGDEPYLLLAAACLSNHAGAGHVCLPLEQLQGDRL
FDGRDPVLARQIMQLLGSPNVERWRSELQRCEPVDDGHRPTPLVLERDMLYLQRSWRNEC
QVAHFIANGQLTTDMDERHIRQVLDTLFPTVEKEVDWQKIAAAVALTSRMAVISGGPGTG
KTTTVAKLLAALIALRGDAQPLRIQLAAPTGKAAARLTESLGVALRQLTLSEAQLRSFPQ
AACTLHRLLGAMPDSQQLRHHRDNPLHLDLLVVDEASMVDLPMMAHVMAALPAHARVIFL
GDRDQLASVEAGAVLGDICHFTGQGYSPARTEQLQRLTGCALPPPSPKASSVADSICLLR
KSYRFAASSGIGLLAQAVNQGDERRVKDVWHGGYSDVGCHPLREASDYQQLLTLAVTEYR
RYLQAIDDGAEPAVVLRAFQQFRLLCALREGPFGVEGLNQGIEQALRSARLIPALPANGS
RWYVGRPVMIARNDTILGLFNGDIGIALLNAQGELRVCFPLPDGSVKPVPPSRLPPHETA
FVMTVHKSQGSEFEHTALVLPNMMLPLLTRELIYTAITRARQQLSIFADEDILCQSVCAA
TRRYSGLAQRILMLAQ
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagttactgcttgaggctcagcgcaggcatctgttgcgcccgctggatgtgcag
tttgcccacatgctggcaggggatgaaccctacctgctgctggcggcggcatgtctgagc
aatcatgccggggcggggcatgtctgcctgcctttggagcagttacagggtgatcgtttg
tttgacggacgtgaccctgtgttggctcgccagataatgcagttgctcggctctccaaat
gtggagcgctggcgtagcgagttgcagcggtgtgagccggtcgacgatggtcatcggcca
acgccgttggtgctggagagggatatgctctatctacagcgcagttggcggaacgaatgt
caggtagcgcattttatcgccaacgggcaactgacgacggatatggatgagcgccatatc
cgtcaggtactagacactctgttcccgacggtggaaaaagaggtcgactggcagaagatt
gcggctgccgtggcgttgaccagccgcatggcggtgatttccggcggtcccggtacaggg
aaaaccactacggtcgccaaactgctggcggcgctgattgcgttgcgtggcgacgcccag
ccgttgcgtatccaactggctgcgccgaccggcaaggccgccgcccgtctgacggaatct
ctgggcgttgcgcttcgccaattgacgctgagcgaggcgcagttgcgcagttttccgcaa
gccgcatgcacattgcatcgtttgctgggtgcgatgccggatagccagcagttgcgtcat
catcgtgataatcccttgcatcttgatctgttggtggtggatgaagcctcaatggtggat
ttaccgatgatggcgcatgtgatggcggctctgcctgcgcatgcccgcgttatctttctg
ggggatcgcgatcagttggcgtccgtggaggcgggtgcggtgctgggcgatatctgtcat
ttcaccgggcaggggtatagcccggctcgtaccgaacagctacaacgtttgaccgggtgt
gcgttgccgccgccatcgccaaaggcatccagcgtggcggatagcatctgcctgttgcgc
aaaagctaccgttttgccgcatcgtcaggcatcgggttgctggcgcaggcggtgaatcag
ggagatgaacggcgggtgaaagacgtttggcacggcggctatagcgacgtcggatgtcat
ccgttgcgggaagcgtcggattaccaacagttgctgacgctggcggtgacggagtatcga
cgttatctacaggcgatcgacgacggcgccgaaccggcggtggtgctgcgcgcgttccag
caatttcgcctgctttgcgctctgcgggaagggccgttcggcgtagaggggttgaatcag
ggtatcgagcaggcattgcgcagcgccaggttgatccccgcgttacccgccaatggctct
cgttggtacgtcggaaggccggtgatgatcgcgcgtaatgacactattctggggctgttt
aacggtgatatcggtatcgcattgctgaatgcgcagggtgaactgcgggtctgcttccca
ttgccggatggcagcgtcaaaccggtgccgcccagccgtctgccaccgcatgaaactgcg
tttgtcatgacggtgcataaatctcaagggtctgagtttgaacatacggcattggtgttg
cccaacatgatgctgcctctgctgacccgagaattgatttacaccgcaataactcgcgca
cgccagcagttgtcgatatttgccgacgaagacattctgtgtcagtccgtgtgcgccgct
acccggcgttatagcggcctggcgcagcgtattctgatgctggcgcagtag

DBGET integrated database retrieval system