KEGG   Dickeya paradisiaca: Dd703_3260Help
Entry
Dd703_3260        CDS       T00927                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dda  Dickeya paradisiaca
Pathway
dda00010  Glycolysis / Gluconeogenesis
dda00620  Pyruvate metabolism
dda00640  Propanoate metabolism
dda00680  Methane metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_3260
   00620 Pyruvate metabolism
    Dd703_3260
   00640 Propanoate metabolism
    Dd703_3260
  Energy metabolism
   00680 Methane metabolism
    Dd703_3260
Enzymes [BR:dda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dd703_3260
Lipid biosynthesis proteins [BR:dda01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dd703_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACS87022
JGI: Dd703_3260
UniProt: C6CDF1
Position
3817632..3819593
Genome map
AA seq 653 aa AA seqDB search
MSQNNKHPIPTNIAENALITAEQYKSMYQASVQDPESFWREQGKIIDWITPYTQVKNTSF
DPGHIRIRWFEDGTLNIAANCLDRHLDSLGDQTAIIWEGDNAKESKTLTYRELHQSVCRF
ANVLKSQGITKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPESIAGRIVDSSA
KLVVTADEGIRAGRVIPLKKNIDEALANPAVTTVTSVIVFQRTGGTPGNWHDGRDLWWHD
LIAQADDHCPPEAMDAEDPLFILYTSGSTGKPKGVLHTSGGYLVYASTTFKYVFDYHPGD
IYWCTADVGWITGHSYLVYGPLACGATTLMFEGVPNWPDASRMAQVVDKHQVNILYTAPT
AIRALMADGDKAILGTSRHSLRIMGSVGEPINPEAWEWYFQKIGNSHCPIVDTWWQTETG
GFMITPLPGAIETKAGSATLPFFGIQPALVDNMGNPQEGACEGNLVITDSWPGQARTLFG
DHDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSH
PKIAEAAVVGIPHSIKGQAIYAYVTLNHGEEPTSELYTEVRNWVRKEIGAIATPDILHWT
DALPKTRSGKIMRRILRKIAAGDTSNLGDISTLADPGVVEKLLEEKQAMDTPS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaataacaaacacccgatccccaccaacatcgctgaaaacgccttaatcacc
gccgaacaatacaaatctatgtatcaggcatccgtacaggatcctgaatcattttggcga
gaacaaggcaagatcatcgattggattacaccgtacacccaagtcaaaaatacctctttt
gatccaggacatatccgtatccgctggttcgaggacggtacattgaacatcgcggccaac
tgcctcgaccgccatttggatagcctgggcgatcaaactgcgatcatctgggaaggcgat
aatgccaaagagagtaaaacactcacctaccgggaactgcatcagtcagtatgccgcttt
gctaacgttctaaaatcacaaggtataactaaaggcgacgtcgtggccatctacatgccg
atggtgcctgaagctgcggtagccatgctggcctgcgcccgtatcggcgcggttcattcc
gttatcttcggcgggttttcgccggaatcgattgccggccgaatcgtcgactccagcgcc
aaactggtcgtcactgcagatgaagggatacgtgcaggtcgggtcatcccattgaagaaa
aacatcgatgaggcactggccaaccccgccgttaccactgtaaccagcgtgatcgtattc
cagcgtaccggtggtactcccggtaattggcatgatgggcgcgacttatggtggcacgat
ctgatagcgcaagccgacgatcactgcccgccagaagctatggatgcagaagatccactg
tttatcctctatacctcgggttctaccggcaagcccaaaggggttctgcataccagtggt
ggttatctggtctatgcgtctacgaccttcaaatatgtcttcgactaccatcctggcgat
atctactggtgtactgccgatgttggttggatcaccggacacagctatcttgtttacggt
ccgcttgcttgcggcgcgacgacattgatgttcgagggcgttcccaactggcccgatgcc
agccgcatggcccaggtcgtcgacaaacatcaggtcaatattctgtacaccgcgccaacc
gcaatccgtgccttgatggcggacggtgataaagccattttgggcacgtcacgtcattcg
ctgaggatcatgggatcggtaggcgaacctatcaacccggaagcctgggagtggtacttc
cagaaaatcggcaacagccactgtccgattgtagatacctggtggcaaaccgagaccggg
ggattcatgatcaccccgctccctggcgccatcgaaaccaaagcgggatccgccacctta
cccttcttcggcatacaacctgctctggtagataacatgggcaacccgcaagaaggcgcc
tgcgaaggtaatctggtcatcaccgattcctggccaggccaggcgcgtacattgtttggc
gatcacgatcgattcgaacaaacttacttttctaccttcaaaggcatgtatttcagcggt
gacggcgcacgtcgggatgaagacggctactactggatcacaggccgtgtcgacgatgtg
cttaatgtgtccggccaccgtctgggaaccgcggagatcgaatccgcactggtctcccat
cccaagatcgctgaagcggcagtcgtcggcattccgcacagcatcaaaggtcaggcgatt
tacgcttatgtcacgctcaatcatggcgaggaacccaccagcgagctttataccgaagtt
cgcaactgggttcgcaaagagattggcgccattgccacgccggatattttgcactggacc
gatgccctgcccaaaacgcgatccggcaagatcatgcgacggatccttcgcaagatcgct
gctggcgacaccagcaatcttggtgatatttccacgcttgccgatccgggcgtcgtggag
aaattgttggaagaaaaacaagcgatggatacgccgtcttaa

DBGET integrated database retrieval system