KEGG   Dickeya dadantii Ech703: Dd703_3299Help
Entry
Dd703_3299        CDS       T00927                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dda  Dickeya dadantii Ech703
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3865547..3866266)
Genome map
AA seq 239 aa AA seqDB search
MKKQVLLLAVLTAMMSGGVAQADDAAIKQTLSRLGLQNAEIQPAPVAGMKTLLTESGVLY
ITEDGKHLLQGPLYDVGGKTPVNVTNGILMNKMEALKDQMIVYKAAKEKHVITVFTDIIC
GYCHKLHEQMKDYNALGITVRYLAFPRQGLNSQAEKDMQSIWCVADRNKAFDAAMKGDEI
SPATCKTAIAPHYQLGILFGVQGTPAIVLDDGTVVPGYQDPKEMMAMLEAHRASQKSGG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaggtattactgctggcggtactgacggcgatgatgagcggcggcgttgct
caggcggatgacgcagccatcaaacaaacgctgagccgtctcggcttgcaaaacgccgag
atccagccggcgccggtcgcggggatgaaaacgctgttgacggaaagcggcgtgctgtac
atcaccgaggacggcaagcatctgttgcaggggccgttgtacgatgtcggcggtaaaaca
ccggttaacgtcaccaacggtatcctgatgaacaagatggaagcactcaaagatcagatg
atcgtgtacaaagccgcgaaggagaaacatgtgatcacggtatttaccgatatcatctgc
ggctactgtcacaagctgcatgagcagatgaaagactataacgcgctgggcattaccgtg
cgttatctggcgtttccgcgtcaggggctgaactcgcaggcggagaaagacatgcagtcc
atctggtgcgtggcggatcgcaacaaggcgttcgacgcggcgatgaaaggcgatgagatt
tcgccggccacctgtaaaactgccatcgcgccccattatcagttgggtattctgttcggc
gtccagggcacgccggcgatcgtgctggatgacggtacggtggtgccggggtatcaggat
ccgaaagagatgatggctatgctggaggcgcatcgggcgtcgcagaaatcgggtggttaa

DBGET integrated database retrieval system