KEGG   Dickeya dadantii Ech703: Dd703_3324Help
Entry
Dd703_3324        CDS       T00927                                 

Definition
DNA polymerase III psi subunit
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
dda  Dickeya dadantii Ech703
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dd703_3324
   00240 Pyrimidine metabolism
    Dd703_3324
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dd703_3324
   03430 Mismatch repair
    Dd703_3324
   03440 Homologous recombination
    Dd703_3324
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Dd703_3324
DNA replication proteins [BR:dda03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Dd703_3324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3893253..3893690
Genome map
AA seq 145 aa AA seqDB search
MASRRDWLLQQLGMTQWVLRRPAALRGEIAVNLPSAVRLLIVADPLPANDDPLLLDVLRS
LALAPEQSYSLTPQQAAMLPEPIHCHCWWQGVAPSREPDGVQLTSPALAELSYNAGAKRA
LWQQIYHHEHNFHSDRRRSDGSLPD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacgacgggactggctgctacagcaattggggatgacgcagtgggtattgcgt
cgtccggccgcgttgcggggcgaaatcgccgtcaacctgccgtcggcggtgcgcttgctg
atcgtcgccgacccgctgccggccaatgatgacccgctgctgctggacgtgctgcgcagt
ctggccctcgcgccggaacaatcctacagcctgacaccgcagcaggcggcgatgctgccc
gaacctattcactgccactgctggtggcagggcgtggcccccagccgtgaacccgacggc
gtgcagttgaccagcccggcgcttgccgagctttcctataacgccggggcgaaacgcgcc
ctgtggcaacagatttatcaccatgaacacaatttccactctgaccgacgccgatctgac
ggcagcctaccggattga

DBGET integrated database retrieval system