KEGG   Dickeya paradisiaca: Dd703_3324Help
Entry
Dd703_3324        CDS       T00927                                 

Definition
(GenBank) DNA polymerase III psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
dda  Dickeya paradisiaca
Pathway
dda00230  Purine metabolism
dda00240  Pyrimidine metabolism
dda01100  Metabolic pathways
dda03030  DNA replication
dda03430  Mismatch repair
dda03440  Homologous recombination
Module
dda_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dd703_3324
   00240 Pyrimidine metabolism
    Dd703_3324
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dd703_3324
   03430 Mismatch repair
    Dd703_3324
   03440 Homologous recombination
    Dd703_3324
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Dd703_3324
DNA replication proteins [BR:dda03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Dd703_3324
DNA repair and recombination proteins [BR:dda03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Dd703_3324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: ACS87086
JGI: Dd703_3324
UniProt: C6CDZ2
Position
3893253..3893690
Genome map
AA seq 145 aa AA seqDB search
MASRRDWLLQQLGMTQWVLRRPAALRGEIAVNLPSAVRLLIVADPLPANDDPLLLDVLRS
LALAPEQSYSLTPQQAAMLPEPIHCHCWWQGVAPSREPDGVQLTSPALAELSYNAGAKRA
LWQQIYHHEHNFHSDRRRSDGSLPD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcacgacgggactggctgctacagcaattggggatgacgcagtgggtattgcgt
cgtccggccgcgttgcggggcgaaatcgccgtcaacctgccgtcggcggtgcgcttgctg
atcgtcgccgacccgctgccggccaatgatgacccgctgctgctggacgtgctgcgcagt
ctggccctcgcgccggaacaatcctacagcctgacaccgcagcaggcggcgatgctgccc
gaacctattcactgccactgctggtggcagggcgtggcccccagccgtgaacccgacggc
gtgcagttgaccagcccggcgcttgccgagctttcctataacgccggggcgaaacgcgcc
ctgtggcaacagatttatcaccatgaacacaatttccactctgaccgacgccgatctgac
ggcagcctaccggattga

DBGET integrated database retrieval system