KEGG   Dickeya dadantii Ech703: Dd703_3332Help
Entry
Dd703_3332        CDS       T00927                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
dda  Dickeya dadantii Ech703
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dda00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3902138..3903472)
Genome map
AA seq 444 aa AA seqDB search
MFLTQEIIRKKRDGHPLSAEEIRFFINGIRDNSVSEGQIAALAMTIFFHDMNMDERVALT
LAMRDSGTVLDWKGLDLHGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGLDILPTDARFRQIIQDVGVAIIGQTNSLAPADKRFYATRDITATVDSI
ALITASILAKKLAEGLDALVMDVKVGSGAFMPTYEQSEQLAQAIVGVANQAGCRTSALLT
DMSQVLASSAGNALEVREAVRFLTGEQRNPRLFEVTMALCEDMLLAGGLANSTADARARL
QAVLDNGRAAEVFGRMVAAQRGPADFVEHYDRYLQAATLSKPVFAEQNGFVNAMDARGLG
MAVVALGGGRRQASDTIDHSVGLSDMVSLGEYVDTQRPLAVIHANTEADWQQAAQAIRDA
ITISGQPPAPCPLIYRRLSAADAQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgtttttgactcaggaaatcatccgtaaaaaacgggatgggcatccgctcagtgcggaa
gagattcgctttttcatcaatggaatacgtgacaacagtgtgtcggaggggcagatcgcg
gcgctggcgatgaccatctttttccacgacatgaacatggacgagcgcgtggcgctgacg
ctggcgatgcgtgattccggcaccgtgctggactggaaagggctggatctgcacggcccg
ctggtggacaagcattccaccggcggcgtcggcgacgtcacttccctgatgctggggccg
atggtggcggcctgtggtggttacgtaccgatgatttctggccgtgggctgggccacacc
ggcggtacgctggacaagctggagtcgattccgggcctggatattctccccaccgacgcg
cgtttccgccagattatccaagatgtcggcgtggcgattatcgggcaaaccaactcgctg
gcgccggcagacaaacggttttatgccacgcgggatattaccgccacggtggattccatt
gcgctgattaccgcctcgattctggcgaaaaagctggcggaagggctggacgcgctggtg
atggacgtcaaagtcggttccggtgcgtttatgccgacttatgaacaatcggagcaactg
gcgcaggcgatcgtcggcgtggcgaatcaggcggggtgccgcaccagtgcgttgttgacc
gacatgagccaggtgctggcttccagcgcgggtaatgcgctggaggtacgcgaagcggtg
cgttttttgaccggtgaacagcgtaatccgcgcttgttcgaggtcacgatggcgctctgt
gaagacatgctgctggcgggagggttggccaacagcaccgccgacgcgcgggcccggttg
caggccgtgttggacaacggtcgggcggcggaggtgttcggacggatggtcgcagcgcag
cgcgggccggcggatttcgtcgagcattatgatcgttatctgcaagccgcgacgctcagc
aagccggtgttcgccgagcaaaacgggtttgtcaacgccatggatgcccgagggctgggg
atggcggtggtggctctgggtggtggacgtcgtcaggcgagtgatactattgatcacagt
gtcgggctgagcgacatggtcagcttaggcgagtatgtcgatacacagcgtccgctggcg
gtgatccacgccaatacggaggctgactggcaacaggcggcgcaggcaatcagagacgcc
atcaccatcagcgggcagccaccggcgccttgcccgctgatttatcgtcgcctcagcgcc
gccgatgcgcaataa

DBGET integrated database retrieval system