KEGG   Dickeya dadantii Ech703: Dd703_3747Help
Entry
Dd703_3747        CDS       T00927                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
dda  Dickeya dadantii Ech703
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd703_3747 (fadB)
   01212 Fatty acid metabolism
    Dd703_3747 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dd703_3747 (fadB)
   00650 Butanoate metabolism
    Dd703_3747 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Dd703_3747 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Dd703_3747 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dd703_3747 (fadB)
   00310 Lysine degradation
    Dd703_3747 (fadB)
   00380 Tryptophan metabolism
    Dd703_3747 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dd703_3747 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dd703_3747 (fadB)
   00281 Geraniol degradation
    Dd703_3747 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Dd703_3747 (fadB)
Enzymes [BR:dda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dd703_3747 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dd703_3747 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Dd703_3747 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Dd703_3747 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4347431..4349623
Genome map
AA seq 730 aa AA seqDB search
MLYQGNNLSLNWLENGIAELVFKAESGSVNKLDTRTVASLGDALNVLVRQNALRALLLRS
DKPAFIVGADITEFLSLFAAPEQQLHQWLTHANSIFSQLEDLPIPTLSAINSFALGGGCE
CALATDFRIATPDVRIGLPEVRLGIMPGFGGTVRLPRLLGVDNALEIITAGKELNAAEAL
KVGLVDAIVTDDKLISAALQTLRLAIEGKLDWQARRRPKLQPLRIGRVEAAMSFATARAL
VAQLAGKHYPAPMTAVKTIEAAASLARHDALRLETDNFVALTQSSAAHALVGVFLNEQAI
KSKAKAQATDTSPPEKVAVLGAGIMGGGIAYQSALQGVPVWMKDISDKALNLGMTEAATL
LGKQLERGKLDAAALSGVMARIHPTLTNEGVEQAALIVEAVVENPRIKAQVLAEAEALIG
DDTVLASNTSTIPIATLAAALKRPQRFCGMHFFNPVHRMPLVEVIRGPQTDERTLSRVVA
YAIRMGKTPIVVNDCPGFFVNRVLFPYISAFCLLLRDGADFQFVDAVMEQQFGWPMGPAY
LLDVVGLDTAHHARQVMAAGYPDRMRQDYRDVIDVLTEHQRFGQKTGAGFYRYQTDNKGK
ARKETDSGTETLLAPVCQPSRTFSPEEIVSRMMIPMLNEVARCLEEGIVASPAEADMALV
YGLGFPAFRGGACRYLDTQGISSYLAMAQRFVALGPLYRIPDSLPDMAERRSRYYAPVTP
HAGLAPHSPD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctctatcaaggcaataatctctctctgaactggctggaaaacggtatcgccgagctg
gtgttcaaggcggaatcaggctccgtcaataagctggacactcgcacggtagccagtctc
ggcgacgcgctgaacgtgttggttcgccagaatgcgttgcgggcgctgctgctgcgctcc
gacaaacccgcgtttatcgtcggcgccgatatcaccgaatttctgtcgctattcgcagcc
cccgaacaacagttgcaccaatggttaacgcacgccaactctattttcagtcaattggaa
gatctgccgattcccacgctgtccgccatcaacagctttgcgctgggcggcggttgtgaa
tgcgcgctggcgacggactttcgcatcgccacacccgatgtacgtatcgggctgccggaa
gtccggctcgggatcatgcccggctttggcggtaccgtgcggctgccgcggctactgggg
gtagacaatgcgctggaaatcatcaccgccggcaaggagctgaacgcggcggaggcgctg
aaagtcggcctggtcgacgcgatagtgacagacgacaaactgatctccgccgcgctgcaa
acactgcggctggcgattgaaggcaagctcgactggcaggcgcggcgccgcccgaaactg
caaccgttgcggattggccgcgtcgaggccgccatgagtttcgctaccgccagagcgctg
gtcgcgcaacttgccggcaagcactaccccgcgccgatgacggcggtcaaaaccatcgaa
gccgccgccagtctggcgcgccatgacgctctgcggctggagaccgacaatttcgtcgcg
ttgacgcaaagcagtgccgcccatgcgctggtcggcgtattccttaacgaacaggcgatc
aaaagcaaggccaaagcacaagcgacggatacctccccaccggaaaaagtggcggtgctg
ggcgccggcattatggggggcggcatcgcctaccagtcagcgttgcagggcgtccccgtc
tggatgaaggacatcagcgacaaagcgctcaatctggggatgacggaagcggcgacgctg
ctcggcaaacagttagaacgcggcaaactggacgcggccgcgctgtccggcgtgatggcg
cgcattcatccgacattgaccaacgaaggcgtcgagcaagcggcgttgatcgtcgaagcg
gtcgtggagaacccgcgtatcaaagcgcaggtgctggcggaagcggaagccctgatcggc
gacgacacggtgctggcgtccaatacgtctacaatccccatcgctacgctggcggcggcg
ctaaaacgcccacagcgtttttgcggcatgcattttttcaatccggtacaccgcatgccg
ctggtcgaagtgattcgtgggccgcaaaccgatgagcgcaccctatcgcgcgtggtggcc
tacgccatccggatgggtaaaacccccatcgtggtgaacgactgcccggggttcttcgtt
aaccgggtgctgtttccctatatttcggccttctgcctgttgctgcgcgacggcgcggat
ttccagttcgtggatgccgtgatggaacaacagttcggctggccgatgggcccggcctat
ctgctggacgtcgtggggttggataccgcgcaccatgcccggcaggtgatggcagccggt
tatcccgatcgaatgaggcaggattaccgtgatgtcatcgatgtactgaccgaacaccag
cgcttcggccaaaaaacgggcgcgggcttctaccgttaccaaaccgacaacaaaggcaaa
gcacgcaaagagacggattccggcacagaaacgttgctggcgccggtatgtcagccgtcg
cggacattcagcccggaggagattgtctctcgtatgatgatccccatgctgaacgaagtc
gcgcgttgtctggaagaaggtatcgtcgccagcccggcggaagcagacatggcgctggtc
tacggattgggattcccggcgttccgtggcggcgcctgtcgttatctggatacccagggg
atttcgtcttatctggcgatggcgcaacgctttgttgcattgggcccgctgtatcggata
ccggacagcctgccggacatggctgaacgccggtcgcgttactatgcaccggtcacgccg
catgcgggcctcgctccgcattcaccggattga

DBGET integrated database retrieval system