KEGG   Dickeya dadantii Ech703: Dd703_3803Help
Entry
Dd703_3803        CDS       T00927                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dd703_3803
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dd703_3803
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd703_3803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4417854..4419365
Genome map
AA seq 503 aa AA seqDB search
MSQEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFPQIYPKPGWVEHDPMEIWASQSS
TLVEALAKAGISSDEVAGIGITNQRETVVVWEKETGKPIYNAIVWQCRRTADICEKLKKD
GLEEYIRANTGLVVDPYFSGTKVKWILDHVDGARDRANRGELLLGTIDTWLIWKMTQGRV
HVTDYTNASRTMLFNIHKLDWDERMLEALDIPRSMLPQVRPSSEMYGQTNIGGKGGTRIP
ICGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGTEAVASRHGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDELKLINDAADSEYFATKVKDTNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGANANHIIRATLESIAFQTRDVLDAMQADADTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPQVRESTALGAAFLAGLATGFWNDLDEVKSKTAIEREFRPSIETVE
RNFRYRGWQKAVERARNWEDHDA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaaaagaaatacattgtcgcccttgatcagggaaccaccagctcccgcgcg
gtcgtactggatcacgatgccaacatcgtcagcgtatcccagcgcgagtttcctcagatt
taccctaaaccaggatgggtagagcacgatccgatggaaatctgggcctcacagagctca
acgctggtagaggcattagccaaagcaggtatcagcagtgatgaagtcgctggcatcggc
atcaccaaccagcgagaaacggtggtggtatgggaaaaagaaaccggcaaacccatctac
aacgctatcgtctggcaatgccgccgtaccgccgacatctgtgaaaagctgaaaaaagac
ggtttggaagagtatattcgcgccaataccggcctggtggtcgacccttatttctccggc
accaaagtgaagtggattctggatcacgtcgacggcgccagagatcgcgccaaccggggc
gaactgctattaggcaccattgatacttggcttatctggaaaatgacccaggggcgtgtg
cacgtcaccgactacaccaacgcctcccgcaccatgctgttcaatatccacaaactggat
tgggatgaacgcatgctggaagcgctggatatcccccgttccatgctgcctcaggttcgc
ccctcttccgaaatgtatgggcagaccaatatcggcggcaaaggcggcacgcgcattcct
atctgcgggattgccggcgatcagcaagcggcattatacggccagctgtgcgtccagccg
ggcatggcgaaaaacacctacggtacgggctgcttcctgctgatgaacaccggcaccgag
gccgtcgcttcccgtcatggcttgctgacgaccatcgcttgcgggccgcgcggcgaagtg
aactacgcgctggaaggggccgtgttcatcggcggcgcctctatccaatggctgcgtgac
gaactgaaactgatcaacgacgccgcggattccgaatatttcgccaccaaagtgaaagac
accaatggcgtatacgtcgtgccggcgttcactggcctgggtgcaccctattgggatcct
tacgcacgcggcgctattttcggcctgacccgaggcgccaacgccaaccacattattcgc
gcaacgctggagtctatcgccttccaaacccgcgatgtgctggacgccatgcaggcggat
gccgatacccgtctgcaatcgctgcgggtggatggtggcgcggtcgccaacaacttcctg
atgcagttccagtccgatatcctggggacgcgcgttgaacgtccgcaggttcgtgagtcc
accgcattgggcgccgcattcctggcaggccttgcaaccgggttctggaacgatttggac
gaagtgaagagcaaaaccgctatcgagcgggaattccgccccagcatcgaaaccgttgag
cgtaacttccgttaccgcggctggcagaaagccgttgaacgtgcgcgcaactgggaagat
cacgacgcctga

DBGET integrated database retrieval system