KEGG   Dickeya dadantii Ech703: Dd703_3808Help
Entry
Dd703_3808        CDS       T00927                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dda  Dickeya dadantii Ech703
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd703_3808 (tpiA)
   01230 Biosynthesis of amino acids
    Dd703_3808 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_3808 (tpiA)
   00051 Fructose and mannose metabolism
    Dd703_3808 (tpiA)
   00562 Inositol phosphate metabolism
    Dd703_3808 (tpiA)
Enzymes [BR:dda01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dd703_3808 (tpiA)
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dd703_3808 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dd703_3808 (tpiA)
  Exosomal proteins of melanoma cells
   Dd703_3808 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4422636..4423403
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTNMVLELIAGLRKELSTVDGCGVAIAPPALYLDQAKHQLSGSRIA
LGAQNVDVNLSGAFTGETSAAMLKDLGAKYIIIGHSERRTYHHESDEFIAKKFAVLKETG
LIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAQAFENTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAIAAQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcccttagttatgggcaactggaagctgaacggaagcaccaacatggttctc
gagctgatcgccgggctgcgtaaagagctgagcacggttgatggctgtggtgtcgccatt
gcgccgccggccttgtatctggaccaggccaagcatcaactgtcgggcagccgtatcgcg
ctgggcgcacagaatgtggacgtcaatctttcaggcgcgtttaccggtgaaacctctgcg
gcaatgttgaaagatctcggtgccaaatacatcatcatcggccactccgagcgccggaca
taccaccatgaaagcgatgaattcattgccaaaaaatttgccgttctgaaagaaaccggc
ctgattccggtactgtgcatcggtgaaaccgaagccgaaaacgaagccggccagaccgaa
gccgtctgcgcccgtcagctggacgccgtcctgaacacactcggcgctcaggcatttgaa
aataccgtcattgcctacgaaccggtatgggctatcggtaccggcaaatccgccaccccg
gcgcaggctcaggccgtgcacaaattcattcgcgatcacatcgctaaacaagatgccgcc
attgcagcccaggtcatcatccagtacggcggttccgtcaacgcggccaacgccgccgag
ctgttcacccagccagatatcgacggcgcgctggtgggcggcgcatcgctgaaagccgat
gccttcgccgtcatcgtgaaagctgcggcggaagccaaaaaagcctga

DBGET integrated database retrieval system