KEGG   Dickeya dadantii Ech703: Dd703_3826Help
Entry
Dd703_3826        CDS       T00927                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dda  Dickeya dadantii Ech703
Brite
Enzymes [BR:dda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dd703_3826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4439057..4439602)
Genome map
AA seq 181 aa AA seqDB search
MKTAIKRCSIALIVALGVTLSPGALRTSQEAQQKTASWEDCRASPYYCPAGVLTVGIGST
GSVQNRPYGNDEIARRWVNDMQRAENCVNGNFNGAAMPQSAFEAMTDTAFNLGCSGLMWF
TNRQGSKQRTTIWKHAQAQEWPAMCERLTDFVNSGGQRSAGLVNRRSDFKAWCLRDLAGV
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcgattaaacgctgttcgattgcgctgattgtcgcgcttggcgtcacgctg
tcccccggcgcattgcgcacctcgcaggaagcacagcagaaaacagccagttgggaagac
tgccgggcgtcgccgtattactgccccgccggcgtgctaacggtgggcattggctctacc
ggtagcgtacaaaatcggccgtacggcaatgacgagattgcccgccgctgggttaacgac
atgcagcgggcagagaactgcgtcaacggcaattttaacggcgccgccatgccgcaatcg
gcgtttgaagccatgaccgacacggcgtttaacctcggttgcagcggcctgatgtggttt
accaaccggcagggcagcaagcagcgcaccactatctggaaacatgcccaggcgcaggaa
tggcccgcgatgtgtgaacggctgaccgattttgtcaacagcggcggccagcgctccgcc
gggctggtcaatcgtcgcagcgactttaaagcctggtgcttgcgcgatctggcgggtgtg
ccatga

DBGET integrated database retrieval system