KEGG   Dickeya dadantii Ech703: Dd703_3891Help
Entry
Dd703_3891        CDS       T00927                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dda  Dickeya dadantii Ech703
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd703_3891
Enzymes [BR:dda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Dd703_3891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4506484..4507482)
Genome map
AA seq 332 aa AA seqDB search
MIKPVWRVGMVLLMMWFSMAASAASGWDSYKSRFMTQDGRILDTGNKNISHTEGQGFAML
MAVYFNDRSAFDGLWTWTQTHLQDNKSGLFYWRYNPMDSNPVVDRNNAADGDVLIAWALL
KAGEKWQENRYLLASDVIQKAILARNVVQFAGRTVMLPGANGFNKNSYVILNPSYFLFPA
WQDFARHSHLQAWRQLIDDGLALLGEMRFGKVELPVDWVALNADGTMAPATNWPPRFSYD
AIRIPLYLYWYDAKTLALVPFQLYWRNYSRLNTPAWIDVLNNNTAPYSMRDGLLAIRDLT
MGSPGDIPASLNASEDYYSSSLHLLAYIASGR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagccggtatggcgtgttggcatggtgttactgatgatgtggttcagtatggcg
gcgtcggcggcaagcgggtgggacagctacaaaagtcgttttatgactcaggacggccgg
attttggataccggcaacaagaatatcagtcacacggaagggcaagggttcgccatgctc
atggcggtgtattttaatgatcggagtgcgtttgacggcctgtggacttggacgcaaaca
catttgcaggataacaagagcggtctgttttactggcgttacaatccgatggacagtaat
ccggtggtggatcgcaacaatgctgcggatggtgacgtattgattgcctgggctttactg
aaagccggggagaaatggcaggagaaccgttatctgctggcctcggatgtcattcaaaaa
gcgatcctggcccgtaacgtggtgcaatttgccgggcgtaccgtgatgttgccgggggcc
aacggttttaacaagaacagctatgtcattctcaatccatcctattttttgttcccggcc
tggcaggatttcgcgcgccacagccatcttcaggcctggcgtcagctgattgacgatggg
ctggcgttgttgggcgaaatgcgtttcggcaaggtggaactgccggtggactgggtagcg
ctgaatgcggatggcaccatggcgcccgcaaccaactggccgccccgtttcagctacgat
gccattcgcatccccctctatctgtattggtatgacgccaaaacgttggcgttggtgccg
tttcagctttactggcgtaattactcccggctgaatacgccggcatggattgatgtactc
aataacaataccgcgccttacagcatgcgggatgggttgctggcgatccgcgatctgacc
atgggcagccccggcgatattccggccagcctgaatgcgtcggaggattattactcatcc
agtctgcacctgttggcctatatcgccagcggccgataa

DBGET integrated database retrieval system