KEGG   Dickeya dadantii Ech703: Dd703_3948Help
Entry
Dd703_3948        CDS       T00927                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dda  Dickeya dadantii Ech703
Pathway
dda00230  Purine metabolism
dda01100  Metabolic pathways
Module
dda_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dd703_3948
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dd703_3948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_16 RsgA_GTPase AAA_18 TCRP1 MMR_HSR1 ABC_tran Dynamin_N Viral_helicase1 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACS87701
JGI: Dd703_3948
UniProt: C6C692
Position
4575237..4575860
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRVVRPGEVHGEHYFFVSVD
EFKRMIDEDDFLEYAEVFGNYYGTSRATIEQVLATGVDVFLDIDWQGARQIREKMPLARS
IFILPPSKEELGRRLRGRGQDSEEVIARRMTQAVAEMSHYAEYDYLIVNDDFDLALHDLK
TIIRAERLRLSRQKIRHDALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgttatatattgtttccgctcccagcggggccgggaaatccagcctg
attcaggcgctgctgaaaacccagccgctgtatgacacccaagtgtcagtttcacacact
acccgcgtcgttaggccgggcgaggttcatggcgaacattatttcttcgtttccgtcgac
gagtttaaacgcatgatcgacgaggatgattttttggaatacgctgaggtcttcggcaat
tattacggtacgtcacgcgccaccatcgaacaggtattggcgaccggcgtggatgtcttt
ctggatatcgactggcagggcgcgcgccagattcgggaaaaaatgcccctggcccgcagc
atttttattcttccgccctcaaaagaagaactggggcgtcgtctgcgcggtcgcggacag
gacagtgaagaggttatcgcccgcaggatgacgcaggccgtagcggaaatgagccactat
gccgaatacgattacctgatcgtgaatgacgatttcgatttggcgttacacgatctgaaa
accattattcgcgccgaacgtctgcgcctgagccgccagaagattcgacatgacgcttta
atcaccaaactattggcagactga

DBGET integrated database retrieval system