KEGG   Dickeya paradisiaca: Dd703_3974Help
Entry
Dd703_3974        CDS       T00927                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
dda  Dickeya paradisiaca
Pathway
dda00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dd703_3974
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dd703_3974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase Aldolase Herpes_UL16
Motif
Other DBs
NCBI-ProteinID: ACS87727
JGI: Dd703_3974
UniProt: C6C6B8
Position
complement(4610141..4611067)
Genome map
AA seq 308 aa AA seqDB search
MKSGKLVVLGSINADHILNLEQFPRPGETVIGKQYGVAFGGKGANQAVAAGRSGADISFI
ACVGEDDIGTRICQQLTRDRIDVSAVEAVSGHTTGVALIFVNGEAENMIGIHAGANAAVT
PAYMMRHQQHIVDASALLMQLESPLDTVVEAARLAHQHGTKVILNPAPACPLPDELLALV
DMITPNETEAQILTGVTINTEDDAQRAAQVLHDKGIATVLITLGSRGVWLSEDGQGVRIP
GFRVKAVDTIAAGDTFNGALVTALLESKPMTDAVKFAHAAAAIAVTRRGAQPSVPWREEI
DAFLNGQE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaggcaagctggtagtgttgggcagtattaatgcggaccatattctgaatctg
gaacagtttccacgccctggtgaaacggtgatcggtaaacaatatggcgtagcgtttggc
ggcaagggtgcaaatcaggcggtagctgctgggcgtagtggcgcggatatttccttcatt
gcctgcgttggcgaagatgacatcggtacccgtatttgccagcaattgacccgcgatcgg
atcgatgtttccgctgttgaggctgtttccggtcacaccaccggtgtggcgctgattttc
gttaatggcgaagcagagaatatgatcggtattcatgcaggtgccaatgcggcggttact
cccgcttatatgatgcgccatcagcagcatatcgttgatgcttccgcgcttctgatgcag
cttgagtccccgctggatacggttgtcgaggcggcgcgtttggctcatcagcatggaact
aaagtgattttaaacccggctcctgcttgccccttgcctgatgaactgctggcgttggtg
gatatgatcaccccgaatgaaaccgaagcgcagatcctgaccggtgtgaccattaacacg
gaggacgatgctcagcgggcggcgcaggtgctgcatgataaaggcatagctacggttttg
atcacgcttggcagccgcggtgtctggttgagtgaagatgggcaaggggtgcgtattccg
ggatttcgtgtgaaagctgtcgatactatcgcagccggcgatacctttaacggcgcgctg
gtcactgcgttgctggaatcaaaaccgatgacggacgcggttaaatttgcgcatgccgcc
gccgcgattgcggttactcgccgtggtgctcaaccgtcggtaccctggcgggaagagata
gatgctttcctgaatggacaggagtga

DBGET integrated database retrieval system