KEGG   Dickeya zeae Ech586: Dd586_0195Help
Entry
Dd586_0195        CDS       T01138                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00860  Porphyrin and chlorophyll metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
Module
ddc_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dd586_0195
Enzymes [BR:ddc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dd586_0195
Exosome [BR:ddc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd586_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD TP_methylase
Motif
Other DBs
NCBI-ProteinID: ACZ75092
JGI: Dd586_0195
UniProt: D2C1D1
Position
218958..219980
Genome map
AA seq 340 aa AA seqDB search
MSNVFPGAFPGRRLRRLRRHDFSRRLVAEHQVTVNDLIYPVFVMEGKQGRQEVPSMPGVY
RLTIDELVREAEVIAKLGIPVLSLFPVIEADKKSLLAEEAYNPDGLVQRAVRALKDAVPE
LGLLTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSHAQAGAEIVAPSDMMDGR
IGAIREQLEEQGLVNTQIMAYSAKYASCYYGPFRDALGSSGNLKGGNKKTYQMDPANTNE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMQMAAIQNGWL
QEQPLVMESLLCFKRAGADGVLTYFAKRVAEWLRDDALRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgtttttcccggtgcgtttccaggacgtcgcctgcgccgtctgcgtcgccat
gatttcagccgccgtctggtggcagaacatcaggttacggttaacgacctcatctatccg
gtgtttgtcatggaaggcaagcagggacgtcaggaagtaccctccatgccgggcgtgtat
cgcctgaccattgatgagctggtaagagaagcggaagtgattgccaaactgggtatccca
gtgctgtcgctgttcccggtgatcgaagcagataaaaagtcgttgctggctgaagaggcc
tacaatccggatgggttggtgcagcgtgcggtgcgtgcgctgaaagatgccgtgccggaa
ctagggctgctgaccgatgtggcgctggatccttacacgactcacggtcaggatggtgtc
attgatgaagacggctatgtggtcaacgacattaccaaagagattctggtgcgtcaggcg
ttatctcatgcacaagccggtgcagagatcgtggcccccagcgacatgatggatggccga
atcggtgcgattcgcgaacagctggaagagcaagggctggtgaatacccagatcatggcg
tattccgccaagtacgcgtcttgttactacgggccattccgcgatgcattgggttcctcg
ggcaacctgaaaggcggcaacaagaaaacctatcagatggatccggccaacaccaatgag
gcgttgcaggagatcgcacaggatctgcaggaaggcgctgatatggtgatggtgaaaccg
ggtatgccgtatctggatgtggtccgtcgggtgaaggacaccttcggtgtgccgaccttt
gcttatcaggtgtctggcgagtatgcaatgcagatggcggcaatccagaatggctggctg
caagaacagccgctggtgatggaatcgctgctgtgcttcaagcgtgccggtgcggatggg
gtgctgacctatttcgccaaacgcgtggccgaatggttgcgtgatgacgcgttacgccgc
tga

DBGET integrated database retrieval system