KEGG   Dickeya dadantii Ech586: Dd586_0444Help
Entry
Dd586_0444        CDS       T01138                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ddc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
497710..499221
Genome map
AA seq 503 aa AA seqDB search
MSRDVIIALDEGTSNVKAVAIDALGQVVARASRPLGLMTPHAGWVEQDGEALLAGSFVVV
REVIAQVGAERVAALAISNQRETAIGWRRDNGQPISPALTWQCSRSAPFCEQLRHNQQEA
AIRAATGLPVAPLFSGSKMRWLLDNTPDGHARAACGEICLGTIDAWLLWHLTGGRQFRCD
LSNAARTQLLNLHHLQWDDGMLALFGIPRAALPELMPSASEFGVTCGVPGVADGIPILAM
VGDSHAALYGHGLGRAGGVKATYGTGSSVMAPLGVPDTRITSLATTVAWHDGERAVYALE
GNIPHTGDGVAWMLQATGLNALPETALNEALQTLPASIESTDGVYFVPALTGAGAPWWND
RARGLMCGLSRGSGQAHLVRAALEAISYQIADVVTAMKQHPDFHLAQLMVDGGPTRNAWL
MQFQADLLGCPVARSTTTELSALGAGLLARRMLGRLSDQQLEPLLPTHDSWLPDEARHQR
YQASWQGWQEAVQRTLWQANHPE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtctagagatgtgatcatcgcactcgatgaaggcaccagtaacgtcaaagcggtggcg
attgacgcgctcggtcaggtggtggcgcgtgcgtcacgcccgcttggcctgatgaccccg
catgccggttgggtggagcaggacggtgaggcgctgctggccgggtcattcgtggtggtg
cgcgaggtgatagcccaggtcggggctgaacgggtcgcggcgctggctatcagcaaccag
cgggaaaccgccatcggctggcggcgtgataacggccagccgatctccccggcgctgacc
tggcagtgttcccgctcggcaccgttttgcgaacagttacggcacaaccagcaggaggcc
gctatccgtgcggcgaccgggttgccggtggccccgctgttctccggctcgaaaatgcgc
tggctgctggacaacacgccggatggtcacgcccgtgctgcgtgcggcgagatttgcctc
ggcaccattgatgcctggctgctgtggcacctgactggcgggcggcagttccgttgcgat
ctctccaacgctgcccgtacccagttgcttaatctgcaccacctgcaatgggatgacggg
atgctggcgttgttcggcattccacgcgccgcattgccagagctgatgccatcggccagt
gagttcggcgtaacctgcggtgtgcccggcgtggcggacggcatcccgattctggcgatg
gtgggggattcccacgccgcgctgtacggccacgggttagggcgtgcaggtggggtaaaa
gcgacttacggcactggctcgtcggtgatggcaccgctgggggtgccggatacgcgcatc
acctcgctggcgaccaccgttgcctggcacgatggcgagcgggcggtctatgcgctggag
gggaatatcccccacaccggcgacggcgtggcctggatgctacaggccaccgggctgaac
gccctgccagagacagcgctgaatgaggcgttgcagacgttgcccgccagtatcgagtct
accgacggggtgtatttcgtcccggcgctgaccggtgcgggcgcaccctggtggaacgat
cgcgcacgtggcctgatgtgtgggctcagtcgcggcagtggtcaggcgcatctggtgcgt
gccgctctggaggcgatctcctatcagatagccgatgtggtgaccgcgatgaagcaacac
ccggacttccatctggcgcagttaatggtcgatggtgggccgactcgcaacgcctggctg
atgcagtttcaggccgacctgctgggttgcccggtggcgcgcagcaccaccaccgagctc
tcagcgctgggggctggtctactggcgcggcgcatgctgggccggttgagcgatcaacaa
ctggaaccgttactgccgacgcacgacagttggctaccggacgaggcgcgtcatcagcgt
tatcaggcgagctggcaggggtggcaggaggcggtacaacgtaccttgtggcaggcgaat
catcctgagtga

DBGET integrated database retrieval system