KEGG   Dickeya dadantii Ech586: Dd586_0614Help
Entry
Dd586_0614        CDS       T01138                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dd586_0614
Enzymes [BR:ddc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Dd586_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
684297..685628
Genome map
AA seq 443 aa AA seqDB search
MFLIQEIIRKKRDGHPLSAEEIRFFINGVRDNTVSEGQIAALAMTIFFHDMTMDERVALT
LAMRDSGTVLDWSGLHLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGLDIFPDDEVFRQIIRQVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYEQSEQLAKAIVGVANNAGCRTSALLT
DMNQVLASSAGNALEVREAVRFLTGEQRNPRLFEVTMALCESMLLSGNLARDAAEARAKL
QSALDSGRAAEVFGRMVAAQHGPADFVEHYDRYLQPATLSKPVFAEREGFVSTMDARALG
MVVVALGGGRRQASDIIDSSVGLSDMVSLGDRVDAERPLAVIHARTESDWQQAAQALREA
ICLDSQAPAPCPLIYRRLDIADI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctgattcaggaaattattcgtaaaaaacgggacggccatccgctcagtgcggaa
gagattcgcttttttattaacggtgtgcgcgataacaccgtgtcagaggggcagatcgcc
gcactggcgatgaccatcttctttcacgatatgacgatggatgaacgggtggcgctgacg
ctggcgatgcgcgattccggcaccgtgttggattggtctggcttacacctgaatggcccg
ctggtggacaagcactctaccggtggcgttggcgatgtgacatcgctgatgctggggccg
atggtggcggcttgtggcggctatgtgccgatgatctctggccggggattgggtcacacc
ggtggcacgctggataaactggagtccattccggggctggatatcttccctgatgacgag
gtatttcgtcagattatccgtcaggtcggggtagcgattatcgggcaaaccagctcgctg
gccccggcagacaagcgtttttacgccacccgcgacatcaccgctaccgtggattccatc
ccgctgattactgcttccattctggcgaaaaagctggcggaagggctggatgcgctggtg
atggatgttaaggtcggttccggtgcgtttatgccgacctatgaacagtctgaacaactg
gcgaaggcgattgttggtgttgccaataatgccggttgccgtaccagtgcgctgttaacc
gacatgaaccaggtgctcgcttccagtgcgggtaacgcgttggaagtccgcgaagcggta
cgctttttgactggcgagcagcgtaatcctcgtctgtttgaagtgacgatggcgctgtgc
gaatcgatgttgctgtcgggtaacctggcgcgcgatgccgccgaggcgcgggctaaactc
cagagtgcgttggacagtggccgcgcggcggaggtctttggccgtatggtggccgctcag
catggcccggcggattttgtcgagcactacgatcgttatctgcaaccggcaacgctcagc
aagccggtatttgctgagcgggaaggcttcgtcagcacgatggatgcgcgggcgctgggt
atggttgtggtggcgttgggtggtggccgacgtcaggccagtgatatcattgatagcagc
gtagggttgagcgacatggtcagcctgggcgaccgggtggatgccgagcgtccgctggcg
gttatccatgccagaaccgagtctgactggcagcaggcggcacaggcgttgcgtgaagca
atctgtctggattctcaggcacctgcgccttgccctttgatttatcgccgactggatatc
gcggatatctaa

DBGET integrated database retrieval system