KEGG   Dickeya dadantii Ech586: Dd586_0638Help
Entry
Dd586_0638        CDS       T01138                                 

Definition
Disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ddc  Dickeya dadantii Ech586
Brite
Enzymes [BR:ddc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dd586_0638
Secretion system [BR:ddc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Dd586_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
710381..711097
Genome map
AA seq 238 aa AA seqDB search
MKKRVILLSLLTLAFGNMARADDAAIKQTLNRLGIQNAEVKDSPISGMKTLLTENGVLYI
TDDGKHLLQGPLYDVSGKDPVNVTNHILNDRLNALKDQMIVYKAPQEKHVITVFTDITCG
YCHKLHEQIKDYNALGITVRYLAFPRQGMNSQAAKDMQSIWCVADRNKAFDAAMKGDDVS
PATCKTDIGAHYQLGVLFGVQGTPAVVLSDGTVVPGYQPPKEMMAMLEAHKASLKSGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtgtaatactcctttcgttgctgacgctggctttcggcaacatggcacgc
gcggatgacgccgcgattaagcagacacttaaccgtctgggtatacagaatgcggaagtg
aaagattctcccatcagcgggatgaaaaccctgctgacggaaaatggcgtgctttacatc
accgacgacggcaaacacctgttgcagggcccactgtatgacgtcagcggtaaggatccg
gtgaatgtcaccaaccatattctgaatgatcgtctgaacgcgctgaaagaccagatgatc
gtctataaggcaccacaggaaaaacacgtcatcaccgtgtttaccgacatcacctgcggc
tactgccacaaactgcatgagcagatcaaagattacaacgcgctgggtattaccgtgcgt
tatctggctttccctcgccagggcatgaactctcaggcagcgaaagacatgcaatccatc
tggtgcgtcgcggatcgcaacaaggcgtttgatgcggccatgaaaggggatgatgtctcg
cctgcaacctgtaaaacggatatcggcgcgcactaccaactgggtgtgctgtttggcgtg
caggggacaccggctgtcgtattgagtgacggcacggtggtgccggggtatcagccgcct
aaagaaatgatggctatgctggaagcgcacaaagcctcgctgaaatcaggcggctaa

DBGET integrated database retrieval system