KEGG   Dickeya zeae Ech586: Dd586_0651Help
Entry
Dd586_0651        CDS       T01138                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00521  Streptomycin biosynthesis
ddc00523  Polyketide sugar unit biosynthesis
ddc01130  Biosynthesis of antibiotics
Module
ddc_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Dd586_0651
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dd586_0651
Enzymes [BR:ddc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Dd586_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACZ75544
JGI: Dd586_0651
UniProt: D2BSC5
Position
724212..724763
Genome map
AA seq 183 aa AA seqDB search
MNVIETNIPDVKIIEPTVFGDERGFFMETWQQKKFEDLVVGHACSFVQDNHSKSNKNILR
GLHIQTENTQGKLVRVVSGEVFDVAVDVRKDSATLGKWVGVYLSAENKRQLWIPEGFAHG
FYVTSEEAEFVYKCTNYYHPASEISILWSDSFLDIHWPLLNNQEPLLSDKDKKGMSFEKF
FNR
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttattgagacaaatattcctgatgtgaaaattattgaacccacggtatttggt
gatgaacgtggtttttttatggaaacctggcaacagaagaagtttgaggacttggttgtt
ggacatgcttgtagttttgttcaggataatcactctaaatccaataaaaatattcttcga
gggttacatattcagaccgaaaacacccaaggaaaactggtcagggttgtttctggtgag
gtctttgatgtagcagtagacgttcgtaaagattcggcaacactaggtaaatgggttggt
gtttacctttctgcagaaaataaacgacaactttggattccagagggattcgcacatggt
ttttatgtgaccagtgaagaagctgagtttgtttataaatgtactaattattatcatcca
gcatcagaaatttctattctatggagtgattcttttttagatatccactggccactttta
aataatcaagagcctttgttatctgataaggataaaaaagggatgtcatttgaaaagttt
tttaataggtga

DBGET integrated database retrieval system