KEGG   Dickeya dadantii Ech586: Dd586_1063Help
Entry
Dd586_1063        CDS       T01138                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ddc  Dickeya dadantii Ech586
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd586_1063
DNA repair and recombination proteins [BR:ddc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dd586_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1178543..1179148
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLETLMEALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCSICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
GDIGLDRLEERLASETISEVILATNPTVEGDATANYIAELCAEHGVMASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgcttcttgaaacattgatggaggcgctgcgctgcttacccggcgtg
gggccaaaatcagcacaacgcatggcgttccacctgttgcagcgcgatcgcagcggtggt
atgcgtctggcgcaggcgctgacccgtgccatgtcggaaataggccattgtgccgattgt
cggacttttaccgagcaggacgtttgcagcatttgcgcgaacccgcgccgtcagcagaac
ggccagatttgtgtggtggaaagcccggcggatatccacgccattgaacagaccgggcag
ttcgcgggtcgttattttgtgttgatggggcacctgtcgccgcttgatggcataggccct
ggcgatatcgggctggatcggctggaagaacgtctggcgtcggaaaccatcagtgaggtg
attctggcgaccaacccgacggtggaaggcgacgcaacggcgaattacatcgctgagctg
tgcgccgaacacggggttatggccagccgtatcgcccacggtgtgccggtaggcggtgag
ctggaaatggtggacggtaccacgctgtctcactcgctggctgggcgtcatcctatccgg
ttctga

DBGET integrated database retrieval system