KEGG   Dickeya dadantii Ech586: Dd586_1095Help
Entry
Dd586_1095        CDS       T01138                                 

Definition
Lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dd586_1095
Enzymes [BR:ddc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dd586_1095
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Dd586_1095
Lipid biosynthesis proteins [BR:ddc01004]
 Fatty acid synthase
  Component type
   Dd586_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1223943..1224614)
Genome map
AA seq 223 aa AA seqDB search
MFPLTNVLTKMMNFKNVFCRHVVILLFWGLFSLRAFATDTLLVLGDSLSAGYRMAANQAW
PALLDATWQSRSPAVTVRVVNASISGDTAAQGLARLPVLLQQHQPRWVLIELGGNDGLRG
FPPQDLERELASVITQVKAANAQPLLMQIRLPANYGRRYTESFSAVYPRLATTLGVPLLP
FFMEQVYLKPEWMQDDGIHPNRDAQPFIAQWMATQLDPIIHQH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgttccccctgaccaacgtgcttactaagatgatgaacttcaagaatgttttctgcagg
catgtcgttatccttctattttggggcctgttcagtctgcgcgccttcgcgacagatacg
ctattggtgctgggcgacagcctgagcgcaggctatcgcatggcggcgaaccaggcctgg
cctgcattactggatgcgacctggcagtcgcgctcccctgccgtcacggtccgggtggtg
aacgccagcatcagcggcgacaccgccgctcaggggctggcacgcctgccggtgttgcta
caacagcatcagccgcgctgggtattgattgaactgggcggcaatgacggtctgcgtggg
tttcccccccaagacctggagcgggaactcgccagcgtgattactcaagtcaaagcggcc
aacgcccaaccgttgctgatgcaaatccgcttgccagccaactatggacggcgctatacg
gaatcgttcagcgcggtttatccgcggcttgccacgacgttgggtgttcctctgttgccg
tttttcatggaacaggtttatctcaaaccagaatggatgcaggatgatggcatccatcct
aaccgtgacgctcagccgtttatcgcacaatggatggcgacacagcttgaccccattatt
caccaacactga

DBGET integrated database retrieval system