KEGG   Dickeya zeae Ech586: Dd586_1184Help
Entry
Dd586_1184        CDS       T01138                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00020  Citrate cycle (TCA cycle)
ddc00190  Oxidative phosphorylation
ddc00650  Butanoate metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
ddc01130  Biosynthesis of antibiotics
ddc01200  Carbon metabolism
Module
ddc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ddc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd586_1184
   00650 Butanoate metabolism
    Dd586_1184
  Energy metabolism
   00190 Oxidative phosphorylation
    Dd586_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACZ76068
JGI: Dd586_1184
UniProt: D2BVB4
Position
1320084..1320431
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVIVLYVLYIVGFVASAGNLTYEVWRGFFAMHLTKVF
TLLTLFAILVHAWIGMWQVLTDYIKPLAIRLTLQLAIVVALLVYVIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcctccgcattggggcgtaatggcgtacacgattggttattacttcgc
gcttctgccatcgtcatcgtgctgtatgtcctgtatatcgttggttttgtagccagcgcc
ggtaacctcacgtatgaagtctggcgcggtttcttcgccatgcatctcaccaaggtgttc
accctgctgacgctgttcgccattctggttcatgcatggatcgggatgtggcaggtgttg
actgactatatcaaaccgctggctatccggctgacgttgcagctggctatcgtcgtcgcg
ttgttggtgtacgtcatttatggaactgttgtggtgtggggtgcgtga

DBGET integrated database retrieval system