KEGG   Dickeya dadantii Ech586: Dd586_1188Help
Entry
Dd586_1188        CDS       T01138                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd586_1188
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd586_1188
  Amino acid metabolism
   00310 Lysine degradation
    Dd586_1188
Enzymes [BR:ddc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dd586_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1325996..1327216
Genome map
AA seq 406 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDDVLVEIETDKVVLEVPAIEAGVLEVV
LEAEGATVTSRQVLGRLRPGDNSGKETSEKAQNKESTPAQRHTAGLEDENNDALSPAIRR
LIAEHDLDASAIKGSGVGGRITREDVEKHLAGQKPASKAVEAPVAAQPVAALGGRSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMQPIMDLRKQYGEAFEKRHGVRLGFMSFYI
KAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDVDSLGMAEIEKKI
KELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVN
GQVVILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgtccctgatctgccggaatctgtagctgacgcgactgtc
gctacctggcacaagaaaccgggcgatagcgtccagcgtgatgacgtgctggttgaaatt
gaaaccgacaaagtggtgctggaagtaccggctatcgaagcgggtgtactggaagtggtg
ctggaagctgaaggcgctaccgtgacatctcgccaggttctggggcgtttgcgtccggga
gataactccgggaaagaaaccagcgaaaaagcacagaacaaagagtctactccggcacag
cgtcacaccgctggattagaagatgaaaataacgatgctttgagtccagcgattcgtcgt
ctgattgccgaacatgacttggacgcatccgctattaaaggcagtggtgtcggcgggcgt
attacccgcgaagatgtggaaaaacacctggcgggtcagaagccagccagcaaagcggtt
gaagcaccggtggcagcacaacctgttgccgcgctgggaggtcgcagcgagaaacgtgtt
ccgatgacccgtctgcgcaagcgcgttgctgagcgtctgctggaagcgaaaaacagtacc
gctatgctgaccacgttcaacgaagtcaacatgcaaccgattatggatctgcgcaagcag
tatggcgaagcgtttgaaaaacgtcatggcgtgcgtctgggcttcatgtccttctacatc
aaagctgtcgtggaagcactgaagcgctatccggaagtgaatgcgtctattgatggcgaa
gatgtggtctaccataactatttcgacgtcagcattgcggtatccacccctcgtggtctg
gtaacgccggtgctgaaagatgtcgactcgctgggtatggccgagatcgagaagaaaatc
aaagagctggcggtgaaaggccgcgacggtaagttgaccgttgaagagctgacgggtggt
aacttcactattaccaacggtggcgtgtttggttctctgatgtcgaccccgattatcaac
ccgccgcagagcgcgattctggggatgcatgctatcaaagatcgcccaatggcagtgaat
ggccaggtggtcatcctgccgatgatgtatctggcgttgtcctacgatcatcgcctgatc
gatggccgcgaatcagtcggtttcctggttactgttaaagaaatgctggaagacccggct
cgcttgttgctggatgtctaa

DBGET integrated database retrieval system