KEGG   Dickeya zeae Ech586: Dd586_1189Help
Entry
Dd586_1189        CDS       T01138                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00020  Citrate cycle (TCA cycle)
ddc00640  Propanoate metabolism
ddc00660  C5-Branched dibasic acid metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
ddc01130  Biosynthesis of antibiotics
ddc01200  Carbon metabolism
Module
ddc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd586_1189
   00640 Propanoate metabolism
    Dd586_1189
   00660 C5-Branched dibasic acid metabolism
    Dd586_1189
Enzymes [BR:ddc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dd586_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACZ76073
JGI: Dd586_1189
UniProt: D2BVB9
Position
1327355..1328521
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEEIRAFAENWLGKRLVTYQTDANGQPVHQILVEGATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPQPYQGRELAFKLGLSGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLVCLDGKLGADGNALFRQPELREMRDHSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGSPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAQK
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaggcaaaacagctctttgctcggtatggtttaccggcaccc
accggttacgcctgcacaacaccgcgtgaagcggaagaagctgcctccaagattggtgct
ggcccgtgggttgttaagtgtcaggtgcatgctggcggccgtggtaaggctggcggtgtg
aaactggtgaacagcaaagaagagattcgcgcctttgctgaaaactggttgggtaaacgt
ctggttacctaccaaacggacgctaacggtcagccggttcatcagattctggtggaaggt
gcaacggatattgataaagagctttatctgggtgctgtagtcgatcgtggtacccgccgt
gtggtattcatggcttccaccgaaggtggtgttgaaattgaaaaagtggccgaagaaacg
ccacatctgattcataaagtcgctctggatcccttgaccgggcctcaaccgtatcaggga
cgcgaactggcgttcaagctggggttaagcggtaagcaggttgcgcagttcaccaaaatc
ttcatggggttggcgacactgttcctggaacgtgacctggcgctggttgaaatcaacccg
ctggttatcactaaacaaggtgacctggtgtgtctggacggcaagctgggtgctgacggt
aatgccctgttccgccagccggaactgcgcgaaatgcgtgaccactcccaggaagatgcc
cgtgaagcacatgctgctcagtgggaactgaactatgtcgcactggatggcaacatcggt
tgtatggtgaatggcgctggtctggcgatgggaaccatggacatcgtgaagctgcacggt
ggttcaccggctaacttcctcgatgtgggtggtggcgcgaccaaagaacgtgtaaccgaa
gcattcaaaatcatcctgtctgatgacaaggtgaaagcggtactggtcaatattttcggt
ggtatcgttcgttgtgacctgattgccgacggtattatcggtgcggtagcggaagtgggc
gtgaatgttccggtcgttgtgcgtctggaaggcaacaatgctgaattgggtgcgcagaaa
ctggcggatagtggtttgaacatcattgctgcgaccagcctgacggatgcggctcagcaa
gtggttgcagcagtggagggtaaataa

DBGET integrated database retrieval system