KEGG   Dickeya dadantii Ech586: Dd586_1189Help
Entry
Dd586_1189        CDS       T01138                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd586_1189
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd586_1189
   00640 Propanoate metabolism
    Dd586_1189
   00660 C5-Branched dibasic acid metabolism
    Dd586_1189
Enzymes [BR:ddc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dd586_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1327355..1328521
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEEIRAFAENWLGKRLVTYQTDANGQPVHQILVEGATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPQPYQGRELAFKLGLSGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLVCLDGKLGADGNALFRQPELREMRDHSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGSPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAQK
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaggcaaaacagctctttgctcggtatggtttaccggcaccc
accggttacgcctgcacaacaccgcgtgaagcggaagaagctgcctccaagattggtgct
ggcccgtgggttgttaagtgtcaggtgcatgctggcggccgtggtaaggctggcggtgtg
aaactggtgaacagcaaagaagagattcgcgcctttgctgaaaactggttgggtaaacgt
ctggttacctaccaaacggacgctaacggtcagccggttcatcagattctggtggaaggt
gcaacggatattgataaagagctttatctgggtgctgtagtcgatcgtggtacccgccgt
gtggtattcatggcttccaccgaaggtggtgttgaaattgaaaaagtggccgaagaaacg
ccacatctgattcataaagtcgctctggatcccttgaccgggcctcaaccgtatcaggga
cgcgaactggcgttcaagctggggttaagcggtaagcaggttgcgcagttcaccaaaatc
ttcatggggttggcgacactgttcctggaacgtgacctggcgctggttgaaatcaacccg
ctggttatcactaaacaaggtgacctggtgtgtctggacggcaagctgggtgctgacggt
aatgccctgttccgccagccggaactgcgcgaaatgcgtgaccactcccaggaagatgcc
cgtgaagcacatgctgctcagtgggaactgaactatgtcgcactggatggcaacatcggt
tgtatggtgaatggcgctggtctggcgatgggaaccatggacatcgtgaagctgcacggt
ggttcaccggctaacttcctcgatgtgggtggtggcgcgaccaaagaacgtgtaaccgaa
gcattcaaaatcatcctgtctgatgacaaggtgaaagcggtactggtcaatattttcggt
ggtatcgttcgttgtgacctgattgccgacggtattatcggtgcggtagcggaagtgggc
gtgaatgttccggtcgttgtgcgtctggaaggcaacaatgctgaattgggtgcgcagaaa
ctggcggatagtggtttgaacatcattgctgcgaccagcctgacggatgcggctcagcaa
gtggttgcagcagtggagggtaaataa

DBGET integrated database retrieval system