KEGG   Dickeya dadantii Ech586: Dd586_1207Help
Entry
Dd586_1207        CDS       T01138                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd586_1207
   01230 Biosynthesis of amino acids
    Dd586_1207
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd586_1207
  Energy metabolism
   00680 Methane metabolism
    Dd586_1207
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd586_1207
Enzymes [BR:ddc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dd586_1207
Exosome [BR:ddc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dd586_1207
  Exosomal proteins of melanoma cells
   Dd586_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1343716..1344468)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWMDVDLSEKGVNEAKQAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKCWKLNERHYGALQGLNKAETAEKYGDDQVKLWRRGFA
VTPPELTRDDERFPGHDPRYASLSDKELPLTESLALTIERVVPYWNENILPRIKKGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTAVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtgcgacatggtgagagccagtggaacaacgaaaac
cgcttcaccggctggatggatgttgatctgtccgaaaaaggcgtcaatgaagccaaacag
gcaggtaaactgctgaaagaagaaggtttcagctttgattttgcctacacctctgtgctg
aaacgtgccattcacaccctgtggaacgtgctggacgagttggaccaggcatggctgcca
gtagaaaaatgctggaaactgaacgaacgtcactacggtgcgttgcagggcctgaacaaa
gcggaaaccgctgagaaatacggtgacgaccaggtgaaactgtggcgtcgcggcttcgcg
gtcaccccgccggaactgacccgtgacgacgaacgtttcccgggccacgacccgcgttac
gcgtcactgagcgacaaagaactgccgctgaccgaaagcctggcgctgaccatcgaacgc
gtagtaccgtactggaatgaaaacattctgccgcgtatcaaaaaaggcgagcgcgtgatc
atcgctgcacacggtaactctctgcgtgcactggtgaaatatctggataacatgagcgaa
gaagaaattctggagctgaatatcccgactgccgtaccgctggtttacgaattcgacgaa
aacttcaagccgctcaaacgctactacctgggcaacgccgacgaaatcgctgcaaaagca
gccgccgtcgctaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system