KEGG   Dickeya zeae Ech586: Dd586_1207Help
Entry
Dd586_1207        CDS       T01138                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00010  Glycolysis / Gluconeogenesis
ddc00260  Glycine, serine and threonine metabolism
ddc00680  Methane metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
ddc01130  Biosynthesis of antibiotics
ddc01200  Carbon metabolism
ddc01230  Biosynthesis of amino acids
Module
ddc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ddc_M00002  Glycolysis, core module involving three-carbon compounds
ddc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd586_1207
  Energy metabolism
   00680 Methane metabolism
    Dd586_1207
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd586_1207
Enzymes [BR:ddc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dd586_1207
Membrane trafficking [BR:ddc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dd586_1207
Exosome [BR:ddc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dd586_1207
  Exosomal proteins of melanoma cells
   Dd586_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACZ76091
JGI: Dd586_1207
UniProt: D2BVD7
Position
complement(1343716..1344468)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWMDVDLSEKGVNEAKQAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKCWKLNERHYGALQGLNKAETAEKYGDDQVKLWRRGFA
VTPPELTRDDERFPGHDPRYASLSDKELPLTESLALTIERVVPYWNENILPRIKKGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTAVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtgcgacatggtgagagccagtggaacaacgaaaac
cgcttcaccggctggatggatgttgatctgtccgaaaaaggcgtcaatgaagccaaacag
gcaggtaaactgctgaaagaagaaggtttcagctttgattttgcctacacctctgtgctg
aaacgtgccattcacaccctgtggaacgtgctggacgagttggaccaggcatggctgcca
gtagaaaaatgctggaaactgaacgaacgtcactacggtgcgttgcagggcctgaacaaa
gcggaaaccgctgagaaatacggtgacgaccaggtgaaactgtggcgtcgcggcttcgcg
gtcaccccgccggaactgacccgtgacgacgaacgtttcccgggccacgacccgcgttac
gcgtcactgagcgacaaagaactgccgctgaccgaaagcctggcgctgaccatcgaacgc
gtagtaccgtactggaatgaaaacattctgccgcgtatcaaaaaaggcgagcgcgtgatc
atcgctgcacacggtaactctctgcgtgcactggtgaaatatctggataacatgagcgaa
gaagaaattctggagctgaatatcccgactgccgtaccgctggtttacgaattcgacgaa
aacttcaagccgctcaaacgctactacctgggcaacgccgacgaaatcgctgcaaaagca
gccgccgtcgctaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system