KEGG   Dickeya dadantii Ech586: Dd586_1254Help
Entry
Dd586_1254        CDS       T01138                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd586_1254
   00052 Galactose metabolism
    Dd586_1254
   00500 Starch and sucrose metabolism
    Dd586_1254
   00520 Amino sugar and nucleotide sugar metabolism
    Dd586_1254
Enzymes [BR:ddc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dd586_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1399538..1400437
Genome map
AA seq 299 aa AA seqDB search
MTALKAIIPVAGLGMNLLPVTKAIPKEMLPLVDRPVIEKIVNECVNAGIKEIVLVTHASK
NAIENHFDTSFELESMLEERAKRQLLAEVKSICPPGVTIMNVRQGQTLGLGHAVSCAHPI
VGNAPFVVVLPDVVMDDSSADQSKDNLALLISRFEETGHSQVLVKHRPYEVLPEYSIVEC
EKPLNQAGDASAITSMIEKPELAPVEGSDLSAVGRYVLTAEAWPILENIVAGAWGRIQLT
DAIAELIKTQQVDAVQMTGRSFNCGRKMGYVQAFVSYGLRNPELGDAFKTKIKALLEKY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattaaaagcgattatccctgttgccggcttagggatgaacttgttgccggtt
accaaagcgattccgaaagagatgcttccgctggttgacaggccggtaatcgaaaagatt
gtcaacgaatgcgttaatgcggggattaaagagattgtgctggtcacgcacgcctctaaa
aatgccattgaaaaccattttgatacctctttcgagctggagtcgatgctggaagagcgc
gccaaacgtcaattactggcggaagttaagtccatttgcccgccgggcgtgaccatcatg
aacgtgcgtcaggggcagacgctgggcctggggcacgcggtgtcctgcgctcacccgatt
gtcggcaatgcgccgtttgtcgtggtgctgccggatgtggtgatggacgacagttcagcg
gatcagtcaaaagacaatctggcgctgctgatttcccgttttgaagaaaccggccacagc
caggtgctggtcaaacaccgcccgtacgaagtgttgccagagtactccatcgtggaatgc
gagaagccgctgaatcaggcgggcgacgcgtcggcgatcacctccatgattgagaaaccg
gaactggcgccggtggaaggctcggacctgtccgcggttggccgttatgtgctgacggcc
gaagcctggccgattctggaaaacatcgtggcgggcgcgtggggtcgtatccaactgacc
gatgctatcgctgagcttatcaaaacccagcaggtggatgcggttcagatgacgggtcgt
agttttaactgcggacggaagatgggatacgtgcaagcgtttgtttcctacggcctgcgc
aacccagaactgggtgatgcctttaaaactaaaatcaaggcgttgctggagaaatattga

DBGET integrated database retrieval system