KEGG   Dickeya dadantii Ech586: Dd586_1618Help
Entry
Dd586_1618        CDS       T01138                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dd586_1618
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dd586_1618
Enzymes [BR:ddc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dd586_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1824559..1825110
Genome map
AA seq 183 aa AA seqDB search
MSNDIYAIPLQTIDGRQTSLENWRNNVLLVVNVASQCGLTRQYEALENLYETYRDRGFAV
LGFPSNEFAGQEPGSNEDIQAFCRGTFGVEFPMFGKIEVNGSGRHPLYQTLIQAQPQALR
PQGSEFYERRVSKGQAPAYPGDILWNFEKFLINRRGNVVARFSPDMTPDDSAIIKAIEQA
LAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgacatctatgcaattcccctgcaaaccatcgacggccgccagacatcactg
gaaaactggcgtaataatgtgctgctggtcgtgaatgtggcctcacagtgtgggctgacc
cgccaatatgaggcgctggagaatctgtatgaaacctatcgtgatcgcgggttcgcggtg
ctgggtttcccttctaatgaattcgccgggcaggaaccgggtagtaacgaagacatacag
gccttctgccgtgggacttttggcgtcgagttcccgatgtttggcaagattgaagtcaat
ggcagtggccgccaccccttgtatcagacactgattcaggctcaaccgcaagcgctgcgg
ccgcaaggcagtgagttctacgagcgccgtgtcagcaaaggtcaggcccccgcataccct
ggcgatattctgtggaatttcgaaaaattcctgattaatcgccgtggcaatgttgtggcg
cgtttttcaccggacatgacgccggatgacagtgcgatcatcaaggcgattgaacaggcg
ctggcgcaataa

DBGET integrated database retrieval system