KEGG   Dickeya dadantii Ech586: Dd586_1618Help
Entry
Dd586_1618        CDS       T01138                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ddc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ddc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1824559..1825110
Genome map
AA seq 183 aa AA seqDB search
MSNDIYAIPLQTIDGRQTSLENWRNNVLLVVNVASQCGLTRQYEALENLYETYRDRGFAV
LGFPSNEFAGQEPGSNEDIQAFCRGTFGVEFPMFGKIEVNGSGRHPLYQTLIQAQPQALR
PQGSEFYERRVSKGQAPAYPGDILWNFEKFLINRRGNVVARFSPDMTPDDSAIIKAIEQA
LAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgacatctatgcaattcccctgcaaaccatcgacggccgccagacatcactg
gaaaactggcgtaataatgtgctgctggtcgtgaatgtggcctcacagtgtgggctgacc
cgccaatatgaggcgctggagaatctgtatgaaacctatcgtgatcgcgggttcgcggtg
ctgggtttcccttctaatgaattcgccgggcaggaaccgggtagtaacgaagacatacag
gccttctgccgtgggacttttggcgtcgagttcccgatgtttggcaagattgaagtcaat
ggcagtggccgccaccccttgtatcagacactgattcaggctcaaccgcaagcgctgcgg
ccgcaaggcagtgagttctacgagcgccgtgtcagcaaaggtcaggcccccgcataccct
ggcgatattctgtggaatttcgaaaaattcctgattaatcgccgtggcaatgttgtggcg
cgtttttcaccggacatgacgccggatgacagtgcgatcatcaaggcgattgaacaggcg
ctggcgcaataa

DBGET integrated database retrieval system