KEGG   Dickeya dadantii Ech586: Dd586_2008Help
Entry
Dd586_2008        CDS       T01138                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd586_2008
Enzymes [BR:ddc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dd586_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2277997..2280042
Genome map
AA seq 681 aa AA seqDB search
MTLTHHDDVVQLLDQWVDCGWLRELDRALVRFLHQECPEASPLLLLGAALVSYQLGRGHV
CLDLAATLADSSFSLALPPEGDRSDNRKIARPAQALAGVTLSAWLAALQQPQLVAPGEGV
TPLVLVGSRLYLRRYWQYEQDVRQAITRQLRHNETLRAAIASAALRQRLEALFPATTPHT
TNWQKLACALAAGSAFSIITGGPGTGKTTTVVKLLALLQSLALEQQGKPLRIRLAAPTGK
AAARLNESIAGAIASLTLDGLAQGEAIRTHINSEVVTLHRLLGSRPDTRHFRHHADNPLL
LDVLVVDEASMVDLEMMAALLAAMPRDSRLILLGDKDQLASVEAGALMGELCQRAAQGHY
LPQTCDWLREVTGEAPDDDLLDPQGNALDQSIVMLRHSYRFGADSGIGKLADAVNRGDNA
ALASVWQHGFADLARLTLAANDDNTLREWVIEGAASRFGAQSGVAAPVGYGDYLRRMAST
RPALTASMEAFDAWATEILAAFGQFQLLCALRNGPWGVESMNERIAHLLYRERLLAGWQG
WYPGRPVMVTRNDYGQRLMNGDIGITLTVPQTQPDGTRLWVTRVAFPVGDGSSGIRWMMP
GRLSAVETVFAMTVHKSQGSEFTHTALLLPDSLSPILTRELVYTGITRAKQAFSLGCVGE
HSTVLAEAVSRRVLRVSGLVE
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcactcaccatgatgacgtggttcaactgctggatcagtgggttgattgcggg
tggttacgcgagttggatcgcgcgctggtgcgctttctgcatcaggaatgcccggaagca
tcaccgctgttgctgctgggtgcggcgctggtcagttatcagcttgggcgcgggcatgtg
tgtctcgatctggccgctacgctggctgatagcagtttttcgctggcgttgccgccagag
ggcgatcgcagtgacaaccgtaagatagcacgcccggcgcaggcgctggcgggggtgacc
ctgtcagcctggctggcggcgttgcagcagccgcaactggtggcgccgggggaaggggta
accccgctggtattggtggggtcgcgtctttatctgcgtcgttactggcagtatgagcag
gatgtccgtcaggcgattacccgacagttacggcacaacgaaaccttgcgtgcagccatc
gcgtcggcggcgctacgccagcggctggaggcactatttcctgcgacgacacctcatacc
accaactggcagaagctggcgtgcgcactggcggcgggcagtgcctttagcatcatcacc
ggtgggccgggtaccgggaaaaccaccacggtggtgaaattgttggcgctgttgcagtca
ctggcgctggagcaacagggcaaaccgctgcgtatccgactggcggcaccgaccggcaag
gcagcggcgcggctaaacgaatccatcgctggcgcgattgccagcctgacgctggacggt
ctggcgcagggagaggcgattcgtacgcacattaacagcgaggtggtaacgctgcatcgc
ttgctgggtagccgaccggatacccgacatttccggcaccatgccgataatccgctgctg
ctggatgtgctggtagtggatgaggcctcgatggtggatctggagatgatggcggcgtta
ctggccgccatgccgcgcgattcccggctgattttgctgggcgacaaggatcaactggcg
tcggtggaggcgggggcgttgatgggggaactctgtcaacgcgccgcacaggggcattac
ctgccacagacctgtgactggttgcgtgaggtgaccggagaggcaccggatgacgacttg
ctcgacccgcagggcaatgcgctggatcagtcgattgttatgctgcgtcacagttaccgt
tttggtgctgacagcggtatcgggaagctggccgatgcggtaaataggggagataacgcg
gcgctggcgtctgtctggcaacatgggtttgccgatttggcacgactgacgctcgccgcg
aatgatgacaacacattgcgtgaatgggttatcgagggcgctgccagccgattcggggct
caatctggtgtggcggctccggtgggctacggtgactacctgcggcgtatggcgtcgaca
cggccagcgctgacggcatctatggaggcgtttgacgcctgggctacagagattctggcg
gcgtttggtcagttccagttgctgtgtgcgttgcgtaatgggccgtggggcgtggagagc
atgaacgaacgcatcgcccatttgctgtatcgggaaaggctgctggctggctggcaaggc
tggtaccccggaaggccggtgatggtgacccgcaacgattatggtcagcggctgatgaac
ggtgatatcggcattacgttgacggtaccgcagacgcagccggacggtacccggctatgg
gtcacccgggtggcgttcccggtcggtgacggctcctcaggcattcgctggatgatgccg
gggcgcttgtcggcggtggaaaccgtgttcgccatgacggtgcataaatcacaagggtcg
gaattcactcacaccgcgttgctactacccgatagcttaagcccgattctgacccgtgaa
ctggtttataccggcatcacccgtgcgaagcaggccttcagccttggttgtgtcggcgaa
cacagtacggtgctggcagaggcagtcagccgacgggtactccgggtcagcggactggtg
gagtag

DBGET integrated database retrieval system