KEGG   Dickeya zeae Ech586: Dd586_2122Help
Entry
Dd586_2122        CDS       T01138                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01130  Biosynthesis of antibiotics
ddc01230  Biosynthesis of amino acids
Module
ddc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dd586_2122
Enzymes [BR:ddc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dd586_2122
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Dd586_2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ACZ76976
JGI: Dd586_2122
UniProt: D2C0Q5
Position
2408811..2410202
Genome map
AA seq 463 aa AA seqDB search
MNMQETVLTKIVRDKALWVAERKQQQPLDSFQSQVTPSSRHFYQSLKKASPAFILECKKA
SPSKGLIRADFDPAAIARVYQDYASAISVLTDEKYFQGDFAFLTQVSAAVAQPVLCKDFI
IDPYQIYLARYYQADAILLMLSVLDDDQYRQLAQVAHSLDMGILTEVSNEAELARAIALE
ARVVGINNRDLRDLSIDLNRTRTLAPQLPASVTVISESGISRYAHIQELSQYANGFLIGS
SLMEEDDLSMAVRRVILGENKVCGLTRPEDAAAAFQAGAVYGGLIFVASSPRHVTTSQAR
TVMAGAPLRYVGVFRDAPLAEIVEAASSLQLAAVQLHGHEDDATVAALREQLPATCQIWK
AQPVGDTLPPLALPLVDRVLLDNGQGGSGQSFNWSLLQGQSLQQVLLAGGLNPDNIAQAA
KFGAAGLDVNSGVESQPGIKDSQKIAAVFQTLRAAQSRRTSHA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcaggaaaccgtattaaccaaaatcgtacgcgacaaggcactgtgggtagcc
gaacggaaacaacaacagccgctcgacagttttcagtcgcaggtcacgcccagttcgcgc
catttctatcagtcgctgaaaaaggccagtccggcatttattctggaatgtaaaaaagcc
tcgccctccaaggggttgatacgggctgactttgacccggctgctatcgcgcgagtttat
caggattacgcctccgccatttcggtgttgaccgacgagaagtactttcagggtgacttc
gcctttctgacccaggtgagcgctgcggttgcccagccggttctgtgcaaagattttatt
atcgacccgtatcagatttacctggcccgttactatcaggcagatgccatcctgctgatg
ctctcagtgttggatgatgaccagtatcgccagttggcacaggtggcacacagtctggat
atgggcattctgactgaagtgagcaatgaagccgaactggcgcgtgccatcgctctggag
gcacgcgttgtcggcattaataaccgcgatttgcgcgacctctccatcgatttgaaccgt
acccgcacactggcaccacagttacccgccagcgtcacggtcatcagcgaatccggtatc
agccgctatgcccatattcaggaattaagtcagtatgccaacggctttctgatcggcagt
tcgctgatggaggaagacgacctgtccatggcggtgcgtcgggttattttgggcgaaaac
aaggtctgtggactgactcgacctgaagatgccgccgccgcgttccaggccggtgcggta
tatggcgggctgatttttgttgccagctcacctcgccacgtgacaacgtcacaagcacgt
accgtcatggctggcgccccgttgcgctatgtcggggtattccgtgacgcgccactggct
gaaatcgtggaagcggcatcatcgcttcaactggcagcagttcaattacatggccatgaa
gacgatgccaccgttgctgccctgcgggaacaactgcctgcaacctgccagatatggaaa
gcccaaccggtcggcgatacgctgccaccactggcattaccactggttgaccgggtactg
ctcgacaacggtcagggcggcagtggtcaatcgttcaactggtcgttgctgcaagggcaa
tcgttacagcaggtattgctggccggtggcctcaacccggacaacatcgcgcaggcggcc
aaattcggcgcggcaggactggatgttaactccggcgtagaatcgcaacccggcatcaaa
gactcacaaaaaattgcggcggtatttcaaacgctgcgtgcggcgcaatcccgccgcacc
tctcatgcataa

DBGET integrated database retrieval system