KEGG   Dickeya dadantii Ech586: Dd586_2123Help
Entry
Dd586_2123        CDS       T01138                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dd586_2123
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd586_2123
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dd586_2123
Enzymes [BR:ddc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dd586_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2410221..2411411
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALRQLEEAFVSAQRDPAFQSEFSDLLKNYAGRPTALTR
CKNLTAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSY
ETAHYLLGTAAGPHPYPTIVREFQRMIGEETKAQVKEREGRLPDAVLACVGGGSNAIGMF
ADFIDEPSVRLIGVEPAGLGIDTGHHGAPLKHGRTGIYFGMKSPMMQTDDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRAEYVSVTDDEALSAFRELSRHEGIIPALESSHALAHALKM
INAEPEKEQILVVNLSGRGDKDIFTVHDILKSRGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacattacttaatccttattttggcgaattcggtggtcagtatgtaccacagattctg
atgcccgccctgcgtcagttggaagaggcgtttgttagcgcacagcgtgatccggcgttt
cagtctgaattcagcgatctactgaagaattatgccggtcgcccgaccgcgctgacacgt
tgtaaaaacctgacggcaggcacccgcaccactctctacctgaaacgtgaagacctgttg
cacggcggtgcccacaagaccaatcaggtattgggtcaggcgttgctggcaaaacggatg
ggcaaaacagaaattatcgccgaaaccggtgcgggccaacatggcgtcgccaccgcgctg
gcgtgtgcgttgttaggattgaaatgccgcgtctacatgggtgccaaggatgtagaacgt
cagtcgccgaatgtgtttcgtatgcgattgatgggcgcagaagtcatcccggtacacagt
ggttctgccacgctgaaagatgcgtgtaacgaggcgctgcgtgactggtccggtagttat
gaaacggcgcattatctgctgggtactgccgccggcccccatccttaccccaccattgtg
cgggaatttcagcgcatgatcggagaggaaacgaaagcccaagtgaaagaaagagaaggt
cgcctgccggatgcagtgctggcctgcgtcggcggtggatccaatgcgattggtatgttc
gccgatttcatcgacgagccttctgtgcgcctgatcggtgtagaaccggcaggccttggg
atcgacaccgggcaccacggcgcaccactgaagcatggtcgcaccggtatttacttcggg
atgaaatcaccgatgatgcagacggatgacggccagattgaagagtcatactcgatttca
gccggtctggacttcccttcagtcggtccgcagcatgcgtacctaaacagtatcgggcga
gctgagtatgtgtcggtaaccgacgacgaagcgctgagcgcctttcgcgagttatctcgt
catgagggtatcatcccggcgctggagtcatcccatgcgttggcacatgcgctgaaaatg
atcaacgctgagccggaaaaagaacaaatcctggtggtgaatctgtccgggcgcggcgat
aaagacatttttacggttcacgacattctgaaatcccggggagaaatctga

DBGET integrated database retrieval system