KEGG   Dickeya zeae Ech586: Dd586_2124Help
Entry
Dd586_2124        CDS       T01138                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00260  Glycine, serine and threonine metabolism
ddc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01130  Biosynthesis of antibiotics
ddc01230  Biosynthesis of amino acids
Module
ddc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd586_2124
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dd586_2124
Enzymes [BR:ddc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dd586_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACZ76978
JGI: Dd586_2124
UniProt: D2C0Q7
Position
2411411..2412220
Genome map
AA seq 269 aa AA seqDB search
MERYHALFKRLSEKQEGAFVPFVTLGDPTPALSLQIIDTLVAAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLATIRQKYPDLPIGLLMYANLVFSNGVDAFYQRCAE
TGVDSVLVADVPVEESAPFRTAAMKQGIAPIFICPPNADDELLREIASFGRGYTYLLSRA
GVTGAETRAQLPLHHLLEKLQEYHAAPPLLGFGISEPTQVQQALTSGAAGAISGSAIVKI
IERYHEQPDTMLAKLSAFVSTMKATTRTH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctaccacgctttgtttaaacggttatctgaaaagcaggaaggggcgttcgta
ccgtttgtcaccctgggtgaccccaccccagccttgtcgctacagattatcgacacgctg
gttgccgccggagccgatgcactggagttgggtatcccgttctccgacccgctggcagac
ggcccaaccattcagaatgccacgctgcgtgccttcgccgcaggcgtaaccccggcgcag
tgttttgaaatgctggccactatccgtcagaaataccctgacctgccgattgggttgcta
atgtatgccaacctggttttcagcaatggtgtcgatgccttttatcagcgttgcgcagaa
accggcgttgactctgtgctggttgcagatgtaccggtggaagagtcagcaccatttcgt
actgcggccatgaaacagggtattgcccctatctttatctgtccgccgaatgccgatgac
gagttactgcgtgaaatcgcttcctttggtcgcggttacacctacctgctctcccgggcc
ggggtaaccggtgcagaaacacgtgctcagctaccgttacatcatttactggaaaaactg
caggaataccatgcggcgccgccgttactcggtttcggtatttctgaaccgactcaggtg
cagcaggcgttaacatctggcgcagccggggcgatttcaggttcagcgattgtcaaaatc
attgagcggtatcatgagcaaccggatacgatgctggcaaaactgagcgcattcgtcagc
acgatgaaagcaaccacccgcactcactga

DBGET integrated database retrieval system