KEGG   Dickeya zeae Ech586: Dd586_2147Help
Entry
Dd586_2147        CDS       T01138                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00040  Pentose and glucuronate interconversions
ddc00052  Galactose metabolism
ddc00500  Starch and sucrose metabolism
ddc00520  Amino sugar and nucleotide sugar metabolism
ddc01100  Metabolic pathways
ddc01130  Biosynthesis of antibiotics
Module
ddc_M00362  Nucleotide sugar biosynthesis, prokaryotes
ddc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd586_2147
   00052 Galactose metabolism
    Dd586_2147
   00500 Starch and sucrose metabolism
    Dd586_2147
   00520 Amino sugar and nucleotide sugar metabolism
    Dd586_2147
Enzymes [BR:ddc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dd586_2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACZ77001
JGI: Dd586_2147
UniProt: D2C0T0
Position
complement(2435446..2436357)
Genome map
AA seq 303 aa AA seqDB search
MSTVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAMLEKRVQRQLLKEVKAICPEHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLKKDNLSEMLQRFYSTGHSQIMVEPVENVSSYGV
VDCKGVELKPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSAQIWDLLKKTEPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMTAFVEYGIRHDALGEDFTQWLKDAIEE
DAN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgttaataaaaaagtaaaaaaagcggtcattccagtggccgggttgggaaca
cgtatgttgcctgcgactaaggccattcccaaagaaatgttgccgctggtcgataagccg
ttaatccagtatgtagttaatgaatgtattgctgccggtatcaatgaaataattttggtt
acacattcttccaaaaattcaatagaaaaccattttgataccagctttgaactggaagct
atgctggaaaaacgtgttcagcgtcagttgttgaaagaagttaaagctatttgtccagag
catgtcactattatgcaggttcgtcaggggctggcgaaaggattagggcacgcagtgctt
tgtgcacatcctttagtgggtgatgaaccggtagcggttattttgccggacgtcatcatc
gatgaatacgaatctgatctgaaaaaagataacctcagtgaaatgctgcaacgtttttat
agcacgggccatagccagattatggtggagccggtggaaaacgtgagtagttacggtgtg
gtggattgtaaaggcgtagaattaaaaccgggtgacagtgcacctatggttggggttgtg
gaaaaacccaaagcgtcagaagcgccgtctaatttggctgtggtgggtcgttatgtgttg
tctgcacagatctgggatctgctgaagaaaacggaacccggcgcggggaatgaaattcag
ctgacagatgctattgccatgctgatggaaaaagaaaccgttgaggcttatcacctgaaa
ggggtaagtcacgactgcggcaataaactgggatacatgaccgcattcgtggaatatggt
attcgtcacgacgcgctgggtgaggactttacccagtggctgaaagacgcgatagaagaa
gacgctaattaa

DBGET integrated database retrieval system