KEGG   Dickeya zeae Ech586: Dd586_2198Help
Entry
Dd586_2198        CDS       T01138                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd586_2198
Enzymes [BR:ddc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dd586_2198
DNA repair and recombination proteins [BR:ddc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Dd586_2198
    RecFOR pathway proteins
     Dd586_2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_8 HHH_3 Transposase_20 FeS_assembly_P Cdd1
Motif
Other DBs
NCBI-ProteinID: ACZ77052
JGI: Dd586_2198
UniProt: D2C0Y1
Position
complement(2486456..2487073)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIIVEKQPPQVLLEVGGVGYEVHMPMTCFYELPDLGQEAVIFTHFVVREDAQLL
FGFNNKQERSLFRELIKVNGVGPKLALAILSGMSAQQFVSAVERQEINALVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNAASDIALPAATGNTTPETDPLAEAEAALVALGYKPQEAG
RMVSKVSRPGADCETLIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtagactcagaggcatcattgtagaaaaacaacccccgcaggtactgctggaa
gtagggggggtgggttatgaagtgcatatgccgatgacctgcttttacgagttgccggat
ctcggtcaggaagcggtgatttttacccattttgtggtgcgtgaagacgcgcaactgttg
tttgggtttaacaataaacaagagcgctctttgtttcgtgaactgattaaagtcaatggc
gtggggccgaagctggcattggcgattctgtcaggcatgtcggctcagcagtttgtcagc
gcggtggaacgccaggaaattaacgcactggtgaaattgccaggagtcggcaagaaaact
gcagagcggctggttgtggaaatgaaagatcgctttaaaggcctgaatggcgatttgttt
aatgctgccagtgatattgccttgccggcggcgaccgggaatacaacaccggaaacggac
ccgctggctgaggctgaagctgcgttggtcgcgctcggttataaaccacaggaagcgggc
aggatggtgagtaaagtgtctcgaccgggcgctgactgcgaaaccctgatcagggatgcg
ctacgcgctgcgttgtga

DBGET integrated database retrieval system