KEGG   Dickeya zeae Ech586: Dd586_2270Help
Entry
Dd586_2270        CDS       T01138                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00340  Histidine metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01230  Biosynthesis of amino acids
Module
ddc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Dd586_2270
Enzymes [BR:ddc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dd586_2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACZ77121
JGI: Dd586_2270
UniProt: D2C1H7
Position
2564594..2565904
Genome map
AA seq 436 aa AA seqDB search
MSNRFDTLIDWQACTQEEQRRLLTRPAISASDRISTIVGEILAAVRKDGDTALRDYSARF
DKVQVDSLRVSAEAIDAAVARLGDDIKQAMANAVRNIETFHNAQKLPPISVETQPGVRCQ
QVTRPIASVGLYIPGGSAPLLSTVLMLATPARIAGCQRVILCSPPPIADEILYAAKLCGV
QEVFQLGGAQAIAAMAFGTDSVPKVDKIFGPGNAYVTEAKRQVSQSLDGTAIDMPAGPSE
VLVIADSGATPDFVASDLLSQAEHGPDSQVILLTPDAAMAQAVINAVERQLATLSRADIA
RQALASSRVIIARDLDQCIDISNQYGPEHLIIQTRNAETLVDRITSAGSVFLGDWSPESA
GDYASGTNHVLPTYGYTATYSSLGLADFQKRMTVQQLSPQGLLGLASTIEIMAQAEQLTA
HKNAVTLRVSTLKEQA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccgcttcgataccttgattgactggcaagcctgtacgcaagaagaacagcgc
cggttactgactcgcccggcaatctctgcctctgaccgtatcagcacgattgtgggcgag
attctggctgccgtgcgtaaagatggcgacactgcgttgcgcgactacagcgcccgtttc
gacaaagttcaggtcgacagcctgcgcgtatccgccgaggcgattgatgccgccgttgca
cgattgggcgatgatatcaaacaggcgatggcgaacgccgtacgcaacattgaaaccttt
cacaacgcacaaaagctgccgccaatcagcgtagaaacccaacccggcgtacgttgccaa
caggtcactcgccccatcgccagcgtcgggttgtatattccgggggggtccgccccgctg
ctctccaccgtactgatgctggcaacccctgctcgcatcgctggatgtcagcgtgtgatt
ctgtgctctccgccaccgattgccgatgagattttgtatgcggcaaaactgtgcggcgtg
caggaagtgttccaactgggtggcgcacaagcaatcgcagcgatggcgttcggcaccgat
agcgtaccgaaggtcgataaaatttttggcccgggcaacgcttatgtcaccgaagccaag
cgtcaggtaagccagtcgctcgacggtacggccattgatatgccagcaggtccgtccgaa
gtgttggtgattgccgatagcggtgccacgccagatttcgttgcctccgacctgctatca
caagccgagcatggccccgattcgcaagtgattctattaacacccgatgccgcgatggca
caagcggtaatcaatgcagtagagcgtcagttggcaacgctgtctcgcgcagacatcgcc
cgtcaggcgctagccagcagccgggtgatcatcgcgcgcgatctcgatcagtgtatcgac
atcagcaatcagtatggcccggagcacctgattattcagacgcgtaacgccgaaacactg
gtcgatcgcatcaccagcgccgggtcggtatttttaggtgactggtcaccggaatctgcc
ggtgattatgcctctggtaccaatcatgtgttgccgacctacggctacaccgccacctac
tccagcctgggactggcggatttccagaagcgtatgacagtacaacagttgtcgccgcaa
gggttgctgggactggcctcaaccattgaaatcatggcgcaggccgaacaactgactgcc
cacaagaacgccgttaccctgcgcgtcagcacccttaaggagcaagcatga

DBGET integrated database retrieval system