KEGG   Dickeya dadantii Ech586: Dd586_2634Help
Entry
Dd586_2634        CDS       T01138                                 

Definition
glycoside hydrolase family 2 TIM barrel
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dd586_2634
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dd586_2634
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dd586_2634
Enzymes [BR:ddc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dd586_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2968629..2971739
Genome map
AA seq 1036 aa AA seqDB search
MSTVSAYVPLSDISLADILARRDWENPACPHIRRLDAHPPFSSWRDLNAARDDKPSDRRQ
LLNGEWTFSYFDRPQAVPEQWLTQDLNDAERITVPSNWQLAGYDAPIYTNVKYPIPVNPP
FVPEDNPTGCYSLTFSVTPDWLAQGQTRIVFDGVNSAFHLWCNGQWVGYSQDSRLPAEFD
LTPCLHVGENRLAVMVLHWSDGTYLEDQDMWRMSGIYRDVYLLHKPVVHLRDVQLTTPLR
HSYTQGTLCVTALANLPEDQAEHWQLAVQLWRGEHLVGEQRKPLGTPAIDERGAYHDRLS
LQLEVAQPALWSAEEPNLYRAVVALECNGSLVEAEAYDVGFREVTIRNGLLLLNGQPLLI
RGANRHEHHPQHGQAIDEATMRQDILLMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYVVD
EANIETHGMQPMSRLSDDPRWLPAYAERVTRMVQRDRNHPCIIIWSLGNESGYGHTHSAL
YQWVKQHDPTRPVQYEGGGANTPATDILCPMYARVDQDQPFPAVPKWSIKKWIGLPGEHR
PLILCEYAHAMGNSFGGFDRYWQAFRQYPRLQGGFVWDWVDQALVREQDGKTHWAYGGDF
GDKPNDRQFCLNGLVFPDRTPHPALYEAQRAQQFFQFSHHDDAPLTLNVTSEYLFRHSDN
EELHWRIMQDDVQLASGRVPLDIAPQGSQTLTLLEQVPAPQHHADMWLTVEVIQPKATDW
SPAGHRCAWNQWQLPMPLARSLPPVHDGKSPSLSQTDEQFEVTQGQQRWVFNRHSGLLTQ
WWRDGQPQLLSPLQDNVTRAALDNDIGISEVDRIDPNAWVERWKLAGLYQYDTDCQHIHA
DTLSDSVLITTEHISHYQQQVLFISRKQWQIDACGVLRVNVEVEMARHLPSPARIGLSVQ
LAAVNPQVSWLGLGPHENYPDRRLAALHGRWQQPLESMHTPYIFPSENGLRCHTQELRYG
NWLIEGDFHFGIGCYSQQQLMSCTHHHLLQPEAGTWLNLDGFHMGVGGDDSWSPSVAPDF
LLTAPRYRYQLQLRLR
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgtttccgcttatgttccgctatccgacatctcgctggcggatattctggcc
agacgcgactgggaaaacccggcctgcccgcacatccgtcgtctggatgcccatccgcct
ttttccagctggcgtgaccttaacgcggcacgcgacgataagccttctgaccggcgtcag
ttactgaatggcgaatggaccttcagctattttgatcgtccgcaagcggtaccggaacag
tggctgacacaggatttaaacgatgccgaacggattaccgttccctctaactggcagtta
gcaggatacgacgcgccgatttacactaacgttaagtaccctattcccgtcaacccgcca
ttcgtaccagaagacaaccctaccgggtgttactcgctcacattttcagtcacccctgat
tggctggcacaagggcagacccgcatcgtattcgacggcgttaactctgcgtttcacctg
tggtgcaacggtcaatgggtcggttattctcaggatagccgcctgccagcggagttcgac
ctgacaccttgcctgcacgtgggcgaaaaccgactggcagtgatggtgttgcattggtct
gacggcacctatctggaagatcaggatatgtggcgcatgagcggcatttatcgtgatgtc
tacctgctgcataaaccggtggtacacctgcgtgacgtgcaactcaccacgccgctgcga
cacagctacactcaggggacattgtgcgtcactgccctggccaacctgccggaagaccag
gctgaacactggcaactggcggtacagttatggcggggcgaacacctggtgggagaacaa
cgcaaaccgctcggcaccccggcgatagatgagcgcggcgcctatcacgacaggctgagt
ctgcaactggaagtggcgcagcccgcgttgtggagcgcggaagagcccaatctataccgg
gcggtagtggcactggagtgcaacggctcgctggtggaagcagaagcctatgacgtcggt
tttcgtgaggtcaccatccgtaacggcttgttgctgctcaacggtcaaccgctgctgatc
cgcggtgctaaccgccatgagcaccacccgcagcacggtcaagcgatcgatgaagcgacc
atgcggcaggatatcctgctgatgaaacagcacaacttcaacgcggtacgctgctcccac
taccccaatcatccgttgtggtatcggctgtgcgaccgctatggcttatacgtggtcgat
gaagccaatatcgaaacccacggcatgcagccgatgagccgcctgtccgacgacccgcgc
tggttacccgcttacgccgaacgcgtcactcgcatggtgcaacgcgaccgcaatcacccc
tgcattattatctggtcgctgggaaatgaatcgggttacggccacacccatagcgcgctt
tatcaatgggtgaaacaacatgatcccacccgaccggtgcaatacgagggcggcggtgcc
aatacgccagcgaccgatattctgtgcccgatgtatgcccgcgtcgatcaagaccagccc
ttccccgccgtcccgaaatggtcaatcaaaaaatggattggcctgccgggcgaacatcgt
ccgctgattttgtgtgaatacgcgcacgcgatgggcaacagttttggcggatttgaccgt
tactggcaggcattccgccagtacccgcgtctgcaaggcggctttgtctgggattgggtg
gaccaagcgctggtacgtgaacaagacggcaaaacacactgggcctatggcggtgacttt
ggtgataaaccgaacgaccgtcagttctgtctcaatggtctggtattccctgaccgtaca
ccgcacccggcgctgtacgaagcccagcgcgcccagcaatttttccagttcagccaccat
gacgacgccccgctgacgctgaatgtcaccagtgaatacctgttccgccacagtgataat
gaagaactgcactggcgcatcatgcaggatgacgtgcaactggcatcaggccgggtaccg
ctcgatatcgccccccaggggagtcagacgctcacgttgctggaacaggtgccagcgcca
cagcaccacgccgacatgtggctgaccgtagaggtgattcagccgaaggcgaccgactgg
tcaccagcgggtcatcgctgcgcctggaatcaatggcagttaccgatgccgctggcacgt
tcactgccacctgttcacgatggcaagtctccatcattgagccaaaccgatgagcaattc
gaagtcacacagggccagcagcgctgggtatttaaccgtcacagcggcttactgacacag
tggtggcgtgatgggcaaccccagttactcagcccattgcaggataatgtgacacgcgca
gcactggataacgacatcggcatcagtgaagtcgaccgtattgacccgaatgcgtgggta
gagcgctggaaactggccgggctgtaccagtacgacaccgattgtcagcacatccacgcc
gacaccctcagcgatagtgtactgatcaccaccgagcacatcagccactatcagcaacag
gtgttattcatcagtcgcaaacagtggcaaatcgacgcctgcggcgtattgagggtgaat
gtcgaggtcgagatggctcgccacctgccctcgccagctcgcatcggcctttccgttcaa
ctggcggcagtcaacccgcaagtcagctggctggggctaggcccgcatgaaaactaccct
gaccgccgccttgccgcgctacacggccgctggcagcagccgctggagtcaatgcacacg
ccatatattttcccatcggaaaacggcctgcgctgccacacccaggaattgcgctacggc
aactggcttatcgaaggggatttccacttcggcatcggctgctacagccagcaacaactg
atgtcatgcacccatcaccatctgctgcaaccggaagccggcacctggcttaatctggat
ggtttccacatgggcgttggtggtgacgattcctggagccctagcgttgccccagacttc
ctgctgacagcccctcgttaccgctaccagttgcaattgcggttacggtaa

DBGET integrated database retrieval system