KEGG   Dickeya dadantii Ech586: Dd586_2930Help
Entry
Dd586_2930        CDS       T01138                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ddc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3302862..3304919)
Genome map
AA seq 685 aa AA seqDB search
MKRFPPLNPKVEGLLHGADYNPEQWENYPGMIDDDIAMMKQVKCNVMSVGIFSWSKLEPQ
EGVYRFDWLDAVIDKLYQQGISVFLATPSGARPAWMSQRYPEVLRVGRDRVPALHGGRHN
HCLSSPVYRDKVQKINTLLAERYGHHPAVIGWHISNEYSGECHCPRCQQAFRHWLQARYQ
TLENLNHAWWSDFWSHTYSDWLQIESPAPQGEVSIHGLNLDWRRFNTAQAKDFCAQEIAP
LKRVNPAIPVTTNFMEYFYDYDYWQLSQVLDVISWDSYPMWHRDKDDATLACYIALFHDL
MRSLKQGKPFVLMESTPSVTNWQPLSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHVDTRVGREVAQLGQILSQLADVAGSRVDAQVAILFDWESRWAMDDA
QGPRNLGLEYEKTVAEHYRPFWEQGIAVDVINADCDFSGYRLLIAPMLYMVRSGFAERLE
QFVRQGGQVVVTYWSGIVNDSDLCYLGGFPGPLRPLLGIWSEEIDCLADGEFNRILGLSD
NDIGLKGPYQARHLCELIHLEGATALASYCDDFYAGRPAVTVNRVGDGKAWYVTSRNDQA
FQRDFFAAIIRELNLPRALDMPFPEAVTAHRRTNGDDEFIFIENYSALPQTLPLPAGYRD
MLTGAPLSDVVLSAWDCRVIRRRLV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatttccgcctttgaatccgaaggtcgaagggttattacatggcgctgattat
aatccggagcaatgggagaattaccccggcatgattgatgacgatatcgccatgatgaaa
caggtgaaatgcaatgtcatgtcggtggggatttttagctggtccaaactggaaccgcag
gagggggtctatcggttcgactggctggatgcggtgattgataaattatatcagcagggc
atttccgtgtttctggcgacacccagcggtgcgcgtccggcctggatgtcgcagcgctac
ccggaagtattgcgtgtcgggcgtgaccgggtgccggccttgcacggtggccgccacaat
cattgcctgtcatcgccggtgtatcgggataaggtccaaaaaatcaatacgttgctggca
gaacgctacgggcaccacccggcggtcatcggctggcatatttctaacgaatacagcggt
gagtgccattgtcctcgctgtcagcaggcctttcgtcactggttgcaggcacgttaccag
acgctggagaacctcaatcacgcctggtggagtgatttctggagccacacctacagcgac
tggttacagattgaatcacccgcgccgcaaggcgaggtgtccattcatgggttgaacctt
gactggcggcgctttaataccgcacaggcgaaagacttctgcgcacaggaaattgcacca
ttgaagcgagtcaatccggctattccggtcaccaccaacttcatggagtatttctacgac
tacgattactggcagttgtcgcaggtactggatgttatttcctgggacagttacccgatg
tggcatcgggataaggacgacgccacgctcgcctgttatatcgccctgttccatgacctg
atgcgctcgctcaagcagggtaaaccgtttgtgctgatggaatcgacccccagcgtgacc
aactggcaaccgctcagcaagctcaaaaaaccgggtatgcatattctctcctcgctacag
gcggtggcgcacggtgcggatgcggtgcagtattttcagtggcgtaagagccgcggttcg
gtggagaaatttcacggcgcggtagtggatcacgtcggccatgttgatacccgcgtcggt
cgtgaagtcgcccaactggggcagatcttatcgcagctcgccgatgtggcaggcagccgg
gtggacgcacaggtggcgattctgtttgactgggaaagccgctgggcgatggatgatgcg
caggggccgcgtaacctgggtctggaatatgaaaaaacggtagcggagcattatcgtcca
ttctgggagcaggggatcgcggtagacgtcatcaacgctgactgtgatttcagcggctat
cggttgctgattgcgccgatgctctacatggtccggtcgggatttgccgagcgtctcgag
cagtttgtccggcaaggtggccaggtggtggtgacctactggagtggtatcgttaacgac
agtgacctgtgttatctgggcggctttcccggcccgctgcgcccgctgttgggaatctgg
tcagaagagattgattgcctggcggacggcgaatttaaccggatactggggctgtcagac
aatgacattgggctgaaagggccgtatcaggcacgccatctgtgcgagttgattcacctt
gagggggcgacggcgctcgccagctactgtgacgatttctatgccggtcgacctgcggta
acggtgaatcgcgtcggcgacggaaaagcctggtacgtcacgtcgcgtaacgaccaggcg
tttcagcgcgatttctttgccgctatcattcgtgagctgaatctgcctcgggcactggac
atgccattccccgaggcggtaacagcacaccgccgcaccaacggtgacgacgagtttatc
ttcattgaaaactacagcgcgttgccgcagacgctcccactgcccgccgggtaccgcgat
atgctgaccggtgcaccgctgagcgatgttgtcctttccgcctgggattgccgggtgatc
cgccgccgtttggtgtaa

DBGET integrated database retrieval system