KEGG   Dickeya dadantii Ech586: Dd586_3087Help
Entry
Dd586_3087        CDS       T01138                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd586_3087
   00500 Starch and sucrose metabolism
    Dd586_3087
Enzymes [BR:ddc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Dd586_3087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3512262..3513359
Genome map
AA seq 365 aa AA seqDB search
MLKTLSGTLALSLMVALSVHQAQAATTYNAVVSKTASDGKTFKTIADAIASAPAGSSSFV
ILIKNGVYNERLTITRNNLHLKGESRNGTVIAAAIAAGTLKSDGSKWGTAGSSTVTISAK
DFSAQSLTIRNDFDFPANQAKSDSDSTKIKDTQAVALYVTKSGDRAYFNDVSLVGYQDTL
YVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGVSGYLTAPSTNINQK
YGLVITNSRVIKESDSVPAQSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHIY
GWDKMSGKDKDGNTIWFYPEDSRFFEYKSYGAGAAKSSARRQLTDTQAAEYTQSKILGDW
TPTLP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaacgctctctggaactcttgcgctgtcgttgatggtcgccctcagcgttcat
caggctcaggcagccaccacctataatgctgtggtgtcaaaaaccgccagcgacggcaaa
acgtttaaaaccatcgccgatgctatcgccagcgcaccggccggtagctcgtcgtttgtc
attctgatcaaaaatggcgtctataacgagcgcctgaccattacccgtaataacctgcat
ctgaaaggggaaagccgtaacggcactgttatcgccgcagcgatagccgcaggaacactg
aagtcggacggcagcaaatggggaaccgcaggcagcagcacggtgaccatcagcgccaaa
gatttcagcgcccaatcactgactatccgcaatgattttgacttcccggccaaccaggcc
aaaagtgacagtgacagtactaaaatcaaggatactcaggccgttgcgctttacgtgacc
aaaagcggcgaccgcgcttacttcaacgatgtgagcctggtcggctatcaggacacgcta
tatgtgtctggtgggcgcagcttcttctctgactgtcgaatcagcggcaccgttgacttt
atctttggcgacggcacagccctgttcaataactgtgatctggtatcacgctaccgtgcc
gatgtgaaaagcggcgtttctggctacctgaccgcacctagcaccaacatcaaccagaag
tatggtctggtgatcaccaacagccgcgtaattaaagaaagcgactcggttccagcgcag
agctatgggctggggcgcccttggcatccgacaacgaccttctctgatggacgttacgcg
gacccgaacgccattggacagacggtattcctgaacaccagcatggataaccatatttac
ggctgggacaagatgtccggcaaagacaaagacggcaataccatctggttctatccggaa
gattcccgtttcttcgagtacaaatcttatggtgccggtgctgcaaaaagctcagcgcgt
cggcagttgaccgatacgcaggcagcggaatacacccaaagcaaaatactgggtgactgg
acgccaacactcccctga

DBGET integrated database retrieval system