KEGG   Dickeya dadantii Ech586: Dd586_3141Help
Entry
Dd586_3141        CDS       T01138                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dd586_3141
Enzymes [BR:ddc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Dd586_3141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3577372..3577860
Genome map
AA seq 162 aa AA seqDB search
MTCVYLALGSNLSEPLQQVHAALRALDAITQTRLVRCSSFYRSRPLGPQDQPDYLNAVAE
LQTELSPEALLDNTQRIELEQGRVRKENRWGPRTLDLDILLFGNLTLHTERLTVPHYDMK
NREFMLYPLAELAPELVFPDGEALATRLQHVPRNGLSLWDEH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacctgcgtttatctggcgttgggaagcaacctgtccgaaccattgcagcaggtacac
gcggcgctgcgcgcgctggacgccataacgcaaacccgactggtgcgttgctcgtcattt
tatcgcagccgcccgctcggcccgcaggatcagcccgactacctcaacgccgtcgccgaa
ttacagaccgaattatcgccagaagcgctgttggataacacccagcgcattgagctggag
caaggtcgggtgcgcaaagaaaatcgctggggcccgcgcaccctcgacctggatatcctg
ttgtttggcaacctgacgctgcataccgagcggcttaccgtaccgcactatgacatgaaa
aatcgcgaattcatgctctacccgctggcagaactggcgccggaactggtgtttcccgac
ggcgaagccctggcaacccgtttgcaacacgtcccccgtaacggcttaagcctgtgggac
gaacactaa

DBGET integrated database retrieval system