KEGG   Dickeya dadantii Ech586: Dd586_3210Help
Entry
Dd586_3210        CDS       T01138                                 

Definition
peptidase dimerization domain-containing protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dd586_3210
  Amino acid metabolism
   00300 Lysine biosynthesis
    Dd586_3210
Enzymes [BR:ddc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Dd586_3210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3655019..3656299
Genome map
AA seq 426 aa AA seqDB search
MSVTSLFQQALAAIANDSDAIVQDMSSMLAVDTSFPPGLGYGAFADLMESLLTPMGFRFQ
RVSVPESLWRSPDGSARGERVNLLATLPGDAVENCNLYFHVDTVPPGDGWHYPPLALSQD
GERLIGRGSADMKGTIVATLAALRAAQKYRLKLRFNPVLLLCTDEEGGLYPGIRYLAEQR
LFQGHMLSFNGGAAPRIWAGCFGSLDVVIRVTGRSGHSGDSVDGINAIEESLPLMNALMA
LKRQVEQRTSAMPPPPHFAGKPLTSRLTLAVAQGGSKGSTLPERFELLVNRRYAPEESFD
AVWQELTDCITQSMASSAALGTEYHLIGHLAPVSDPTGPHWPRWQQALGMGFGFRADEFA
AWGSSSSSDMGWVQQAGIQEILLGGLVRPDNHIHAANEYTTMSDIVALSQSILAYLAEDF
SPTQGH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgacatccctttttcagcaggcattggccgccattgcgaatgattccgacgcc
attgtacaggatatgagcagcatgctggcggtggataccagtttcccgcccggcctgggt
tatggtgcgttcgccgatctgatggagtcactgctaacgccgatgggattccgcttccag
cgggtgtcggtacccgaatccctctggcgttcaccggatggtagcgcacgcggagagcgc
gtcaacctgctggcgacgctgcccggcgacgcggtagagaactgcaacctctattttcac
gttgataccgttccccccggcgacggctggcattacccgccgttagcgctgagtcaggac
ggtgaacggctgatcggccgcggtagcgccgacatgaaaggaacgattgtcgccacgctg
gccgcgctgcgtgcagcgcaaaaatatcgcctcaaactgcgtttcaacccggtgctgttg
ctgtgtaccgacgaagaaggcgggttgtaccccggcattcgctatctggcggaacagcgg
cttttccaaggtcatatgttgagtttcaacggcggtgccgcgccgcgcatctgggccggt
tgtttcggcagtctggatgtggtgatccgtgtgacggggcgctcggggcattccggcgac
tcggtagacggcatcaacgccattgaggagagcctgccgttgatgaacgccctgatggcg
ctgaagcggcaggttgagcaacgcacctccgccatgccgccaccgccacattttgccggc
aagccgctgacctcgcgcctgacgctggcggtggcgcaaggtggtagcaaaggctccacc
ttgccggaacgttttgagttgctggtcaaccgtcgctacgcccccgaagagtcgttcgac
gcggtctggcaagaattgaccgactgcatcacacaatccatggcctcctccgccgcgctg
ggtacggaataccacctgatcggccatctggccccggtcagcgatccgaccgggccacac
tggccgcgctggcagcaagcgctgggcatgggatttggtttccgcgccgacgaattcgcc
gcctggggttcctccagcagttccgacatgggatgggtacaacaggcaggcattcaggaa
attctgttaggcggtctggtgcggccggataaccacattcacgccgccaatgaatacacc
accatgtcggacatcgtcgctttatcccagtctattttggcctatctggccgaggacttt
tcgccaacccagggtcattaa

DBGET integrated database retrieval system