KEGG   Dickeya dadantii Ech586: Dd586_3304Help
Entry
Dd586_3304        CDS       T01138                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ddc  Dickeya dadantii Ech586
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3762380..3763006)
Genome map
AA seq 208 aa AA seqDB search
MVNKRVQTLLEQLRQQGIQDERLLQAMASVPRERFVDEAFEHKAYDNVALPIGSGQTISQ
PYTVARMTELLRLTPVSRVLEIGTGSGYQTAILAHLVQHVFSVERIKGLQWQAKRRLKQL
DLHNISTRHGDGWQGWASKGPFDAIIVTAAPPEIPSALMEQLDEGGIMVLPVGEQQQTLQ
VVVHRHGEFIVQTVETVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacaaacgcgtgcaaacgctgctggaacagcttcgccagcagggaattcaggat
gaacgcctgttgcaggcgatggcttcggttccccgtgaacgctttgttgacgaggcattc
gagcataaagcctatgataatgtcgccctgccaatcggctccggacaaaccatttctcag
ccatacaccgtcgccagaatgacggagttgctacggctgacgccggtatctcgtgtgctg
gaaattggcacggggtccggctatcaaaccgccatcctggcacatctggtgcagcatgta
ttttcagttgagcgcattaaaggcctgcaatggcaggcgaaaaggcgtcttaagcaattg
gatctgcataatatttccacccgccatggtgatggctggcaaggctgggcttctaaaggg
ccattcgatgccattattgtcacggcggcaccgccggagatcccctcggcgttgatggag
caactcgatgaaggcggcattatggtgttgccggtaggggagcaacaacaaacgttacag
gtggtggtgcaccgtcatggtgaatttatcgtccagacggtggaaacagttcggtttgtt
ccgctggtcaaaggggaactggcttga

DBGET integrated database retrieval system