KEGG   Dickeya dadantii Ech586: Dd586_3407Help
Entry
Dd586_3407        CDS       T01138                                 

Definition
glycoside hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3886170..3887606)
Genome map
AA seq 478 aa AA seqDB search
MSKVSMTLPEGFILGAAASAWQTEGWSGKKNGQDSYLDLWYKRDRQVWHNGYGPAIATDF
YNRYREDVALMKQTGLTHFRTSINWSRFMLDYENGVVDEEYAAYIDNLIDEMQREGIEPM
LCLEHYELPAVLFEKYQGWSSKQVVEWFVQYADAVFARYAGKVKRWFTFNEPIVVQTRVY
LDAVRYPYQQDTGTWMQWNHHKNLATAKVVQRFRDKGYHLQGGSIGVILNPEVTYPRSSE
AHDVEAARLYDLFYNRVFLDPALKGEYPAELLALLEKHQVKWDYDAQELAIIRANTVDEV
GINLYYPHRVKAPSRAWNSNTPFHPAYYYEHFELPGRRMNKSRGWEINPRIIYDMAMRLK
DEYGNVPWFVSENGMGIENEGQFKDSHGVIQDDYRIAFIAEHLYWTLKAREDGANCQGYM
LWAFTDNVSPMNAFKNRYGLIEIDLEHDRQRRAKKSAGWFRQVRDSGVLAFELDDEEK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtatcaatgaccctgcctgagggctttattctgggggcggcggcgtccgcc
tggcagaccgaggggtggtcaggcaagaaaaacgggcaggattcctatctggacctgtgg
tacaagcgggatcgtcaggtgtggcacaacggctacggcccggcgatcgccaccgatttc
tataaccgctaccgtgaagacgtggcgctgatgaagcagaccgggctgacgcactttcgt
acctcgattaactggtcgcgcttcatgctggattatgaaaacggcgtggtggatgaagag
tacgccgcttacatcgataacctgatcgacgaaatgcagcgtgaaggcatcgaaccgatg
ctgtgcttagaacactatgagctcccggcggtgctgttcgagaaatatcagggctggtcg
tcaaagcaggtggtggagtggttcgtgcagtacgccgacgcggtatttgcccgctacgcc
ggtaaggtcaaacgctggtttacctttaatgagccgattgtggtgcagacccgcgtgtat
ctggatgcggtgcgctacccttatcagcaggatactggcacctggatgcagtggaaccac
cataaaaacctggcaaccgccaaagtggtgcaacggtttcgcgacaaaggttaccacctg
caagggggcagcatcggggtgatcctgaacccggaagtcacctacccgcgttccagtgag
gcgcatgatgttgaggcggcgcgcctgtatgacctgttctataaccgggtctttctcgac
ccggcgctgaaaggcgaatacccggcagaattactggcgctgctggaaaaacatcaggtg
aagtgggattacgacgcgcaagagctggctatcatccgcgcgaacaccgtggatgaggtg
ggtattaatctctactacccgcaccgggtcaaagcccccagcagggcctggaacagcaac
acgccgttccacccagcttactattacgagcatttcgaattgcccggccgccggatgaat
aagtcgcgcggttgggagatcaacccccgcattatttacgacatggcgatgcgcctgaag
gatgaatacggcaacgtgccctggtttgtgtcggaaaacggtatggggattgaaaatgaa
ggccagttcaaagacagccacggcgtgatacaggacgactaccgtattgcgtttatcgcc
gagcatctttactggacgctaaaagcacgcgaagacggtgccaactgccagggttatatg
ctgtgggcgtttactgacaatgtgtcgccgatgaacgcctttaaaaaccgttacggcctg
attgaaatcgatctggaacacgaccggcagcgcagagcgaagaaatcagccggctggttc
cgacaggtacgggacagcggcgtgctggcgttcgaactggacgatgaagagaaatag

DBGET integrated database retrieval system