KEGG   Dickeya dadantii Ech586: Dd586_3601Help
Entry
Dd586_3601        CDS       T01138                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dd586_3601
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd586_3601
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dd586_3601
Enzymes [BR:ddc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dd586_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4116434..4117723)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVNFAEAIRKGLGSNQGLFFPLELPEFDRTTVDELLEQDFVTRSSRILS
AFMGDEMSDEIVYQRVKAAFRFPAPVVPVSEDIAALELFHGPTLAFKDFGGRLMAQMLAE
VAGDQPITILTATSGDTGAAVAHAFYGLKNVRVVILYPNGKISPLQEKLFCTLGGNIHTI
AIDSDFDACQALVKQAFDDEELKRAIGLNSANSINISRLLAQISYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLQSGAWQPNPTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKDLAFGAVSDETTKATMLELEALGYTSEPHAAIAYRL
LRDQLQPGEYGLFLGTAHPAKFKESVEAILGKTLPLPQALADRADLALLSHHFAPDFALL
RKFLMELPY
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatctgaaagatcacaatgaacaggtgaatttcgccgaggcgatccgt
aaaggactgggaagcaatcagggcctgtttttcccgttggagctgcctgaattcgaccgc
acgaccgttgatgaactgctggagcaggattttgtcacccgtagtagccgcatcctgtcg
gcgttcatgggtgatgaaatgtccgatgaaatcgtctaccagcgtgtgaaagcggcgttc
cgcttcccggcaccggtcgtgccggtgagcgaggatattgccgcgctggagctgttccac
ggtccgacgctggcgttcaaagacttcggcggccgtttgatggcgcagatgctggcggaa
gtggcgggcgatcaaccaatcacgattctgaccgcgacgtctggtgatactggggccgcg
gttgctcatgcgttctacggcctgaagaatgtgcgtgtggtgattctgtacccgaacggc
aaaatcagtccgttgcaggagaaactgttctgtactctgggtggcaacatccacactatc
gccatcgacagcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gagctcaagcgtgctatcgggctgaactctgccaactccatcaacatcagtcgtctgctg
gcgcagatcagttactattttgaagcggtggcgcagttgccgcaggaagcacgtaaccaa
ctggtggtatcggtgcccagtggtaacttcggcgatctgaccgcaggcctgttggcaaaa
tcgctgggcttgccggtgaaacgttttatcgccgcgaccaatgcgaacgataccgtgcca
cgctttttgcaaagcggtgcctggcagccgaacccaacagtggcgacgctctctaatgcg
atggatgtgagccagccaaacaactggccgcgcgtggaggagttgttccgccgtaaaaac
tggcaactgaaggatctggcgttcggtgcggtgagtgacgaaaccaccaaagccaccatg
ctggaactcgaagcgctggggtatacctcggagccgcatgcggctatcgcttaccgtttg
ttgcgtgaccaactgcaaccgggtgaatacggcctgttcctgggtactgcccatccggcg
aagtttaaagagagtgtggaagctattctgggtaaaaccttgccgttaccgcaggcgctg
gctgatcgtgcagatctggcattgctgtcacaccacttcgccccggattttgcgctgctg
cgtaaattcctgatggagctgccgtactaa

DBGET integrated database retrieval system