KEGG   Dickeya zeae Ech586: Dd586_3694Help
Entry
Dd586_3694        CDS       T01138                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00620  Pyruvate metabolism
ddc00630  Glyoxylate and dicarboxylate metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
ddc01200  Carbon metabolism
Module
ddc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dd586_3694
   00630 Glyoxylate and dicarboxylate metabolism
    Dd586_3694
Enzymes [BR:ddc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dd586_3694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACZ78524
JGI: Dd586_3694
UniProt: D2BXE9
Position
complement(4235988..4237586)
Genome map
AA seq 532 aa AA seqDB search
MTQQTISRELVFTAALGDAERQILTTEAVDFLTALVSRFTSQRNHLLAERQVIQARIDSG
ELPGFISEMDSIKNSDWKIRGIPNDLLDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWSKVIEGQINLRDAVRGSIAYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVLWND
EPIPGSLFDFALYFFHNYRQLLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDHVGLARG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKEAERNAWVQEKVRQDKELEARNGH
DGTWIAHPGLADTVMPVFDRLLGDRPNQLDVLREDDAPVTADELLAPCPGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHGKTLSDGRVVTKALFRQ
MLAEEMQVIRGELGDTRFDGGRFEDAGRLMERITTQDALIDFLTLPGYDLLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagacgataagcagggaactggtattcaccgcagcgttaggtgacgcggaa
cggcagattctgacgacggaagcggttgattttctcactgcgctggtaagccggtttaca
tcacagcgcaatcacctgctggccgaacgtcaggtaatacaggcgcggattgatagtggt
gaattaccgggttttatttcggaaatggattccataaaaaattctgactggaaaattcgt
ggtattccgaatgacttgttggatcgccgggtagagattaccggcccggtggaacgcaaa
atggtgattaacgccctgaacgccaatgtgaaagtcttcatggcagactttgaagactca
ctggcacccagttggtcaaaagtgatcgaggggcaaatcaacctgcgtgacgctgtgcgt
ggctccatcgcctacaccaacgaggcaggaaagatttatcagctcaagcccaatcccgcg
gtgttgatttgtcgggttcgtgggttacacctgccggaaaaacatgtgctgtggaatgat
gagcctatccccggtagcctgtttgatttcgcgctctattttttccacaactaccgccaa
ctgttggcaaaaggcagcggcccgtatttctatttgccgaaaacccaatcctggcaggaa
gcagcctggtggagcgaggtgttcagttatgccgaagaccatgttggtttagcgcgcggc
actatcaaagccaccgtattgattgaaaccttgcctgctgtgttccagatggacgagatc
ctgtatcacctgcgtgaccatatcgtcgggctgaactgcggtcgttgggactatatcttc
agttacatcaaaacgttgaagaatcacccggaccgcgtattaccagaccgtcagtcagtg
acgatggacaaaccgttcctgagcgcttactcgcgtttgctgatcaaaacctgtcaccgg
cgcggtgcatttgctatgggggggatggctgcgttcatacccagcaaagaggcggaacgc
aacgcgtgggtgcaagagaaggtcaggcaggacaaagaactggaagcccgcaatggtcat
gacggtacctggattgcccaccccggtttggctgacaccgtgatgccggtgtttgaccgc
ttactgggtgatcgccccaatcagttggatgtgctgcgtgaggatgatgccccggtgacc
gctgatgaactgctggccccttgcccaggcgagcgcaccgaagcgggtatgcgcgccaac
atccgcgtagccgtgcaatacatcgaagcctggatttccggcaacggttgcgtaccgatt
tacggtctgatggaggacgctgccaccgcagagatctcccgcacctccatctggcagtgg
attcaccatggcaaaaccctcagcgatggccgcgtggtaaccaaagccttgttccgccag
atgctggctgaagagatgcaggttatccgcggtgagctgggcgatacccgctttgatggc
ggccgtttcgaggatgcaggccgactgatggagcgtatcaccacgcaagacgcgctaatc
gattttcttaccttacccggttacgacttacttgattaa

DBGET integrated database retrieval system