KEGG   Dickeya dadantii Ech586: Dd586_3950Help
Entry
Dd586_3950        CDS       T01138                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd586_3950
   01230 Biosynthesis of amino acids
    Dd586_3950
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd586_3950
   00051 Fructose and mannose metabolism
    Dd586_3950
   00562 Inositol phosphate metabolism
    Dd586_3950
Enzymes [BR:ddc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dd586_3950
Exosome [BR:ddc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dd586_3950
  Exosomal proteins of bladder cancer cells
   Dd586_3950
  Exosomal proteins of melanoma cells
   Dd586_3950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4516382..4517152
Genome map
AA seq 256 aa AA seqDB search
MRHPLVMGNWKLNGSTSMVHELIAGLRKELSAVTGCDVAIAPPAIYLDQAKHQLAGSRIV
LGAQNVDVNLAGAFTGETSAEMLKDIGAKYIIIGHSERRTYHHESDEFIAKKFGVLKETG
LIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFENTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKGLA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcccttagtcatgggcaactggaagctgaacggcagcaccagcatggttcac
gaactgatcgccggcctgcgcaaagaactgagcgccgtcaccggttgtgacgtagccatt
gcgccacccgctatttatctggatcaggcgaaacaccagctggcaggcagccgtattgtg
ctgggtgcccagaacgtggacgtcaaccttgcgggcgctttcaccggtgaaacatccgct
gagatgctaaaagacatcggcgcgaagtacatcatcatcggccactccgagcgccgtacc
tatcaccatgaaagtgatgagttcatcgccaaaaaatttggcgtgctgaaagaaaccggc
ctgattccggtactgtgcatcggtgaaaccgaagctgaaaacgaagcgggtcagaccgaa
gccgtctgcgcgcgtcagttggacgcggtgctgaacacgctgggcgcgaaagcgttcgaa
aacaccgtcattgcctacgaaccggtatgggccatcggcaccggcaagtccgccacgccg
gcgcaggcacaggccgtgcacaaattcatccgtgaccacatcgctaaacaggatgcggca
gtcgctgaacaggtcatcatccagtacggcggctcggtcaatgcggctaacgctgctgag
ctgttcacccagccggacatcgatggcgcgctggtgggcggtgcctcactgaaagctgat
gcgttcgccgttatcgttaaagccgcggccgaagccaaaggcctggcctga

DBGET integrated database retrieval system