KEGG   Dickeya dadantii Ech586: Dd586_3987Help
Entry
Dd586_3987        CDS       T01138                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd586_3987
   01230 Biosynthesis of amino acids
    Dd586_3987
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd586_3987
   00030 Pentose phosphate pathway
    Dd586_3987
   00051 Fructose and mannose metabolism
    Dd586_3987
   00052 Galactose metabolism
    Dd586_3987
  Energy metabolism
   00680 Methane metabolism
    Dd586_3987
Enzymes [BR:ddc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dd586_3987
Protein phosphatases and associated proteins [BR:ddc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dd586_3987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4553907..4554869)
Genome map
AA seq 320 aa AA seqDB search
MIKRIGVLTSGGDAPGMNAAIRGVVRAALAENLEVYGIYDGYLGLYEDRMAQLDRYSVSD
VINRGGTFLGSARFPAFREEAVRQVCVENMRKHDLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVDFKKEDLVEEIKAGIAKGKKHAIVAITELVCDVDELAHYIETETG
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLNTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaagaatcggagtactgacgagcggtggcgatgcgccggggatgaatgcggcc
attcgtggtgtggtgcgtgccgcgttagcggaaaacctggaagtatacggtatttatgac
ggctatctgggcttgtatgaagatcgcatggcgcagttggaccgctatagcgtgtctgac
gtgatcaaccgcggcggcacgttcctgggttcagcccgtttcccggcgttccgtgaggaa
gcggtgcgtcaggtgtgcgtggaaaacatgagaaagcatgatctggacgcactggtggtg
atcgggggtgacggttcctacatgggggctaaacgcttgaccgagatgggtttcccctgc
atcggcttgccgggcaccatcgacaatgacgtggcaggcaccgattacaccatcggttat
ttcaccgcgctggaaaccgtggtggaagcgattgaccgcctgcgcgatacctcgtcttcc
caccagcgtatttccatcgtggaagtgatggggcgtcactgtggcgacctgacgctggcc
gcagcgatcgccggtggctgtgaattcatcgtgctgccggaagtcgacttcaaaaaagaa
gacctggtggaagagattaaagccggtatcgccaaagggaagaaacacgccatcgtcgcc
attaccgaactggtgtgtgatgtggatgaactggcacactatattgaaacggaaaccggg
cgcgaaacccgcgccacggtgttgggccacatccagcgtggtggttcaccggtggcgtat
gaccgcatcctggcttcccgcatgggcgcgtactccattgagctgttgcagcaaggctat
ggcggccgttgcgtcgggatccagaatgaaaaactggtccatcatgatattatcgacgct
atcgagaacatgaagcgcccgttcaaaggcgactggctgaataccgccaagaagctgttc
tga

DBGET integrated database retrieval system