KEGG   Dickeya dadantii Ech586: Dd586_4206Help
Entry
Dd586_4206        CDS       T01138                                 

Definition
4-hydroxyphenylpyruvate dioxygenase (EC:1.13.11.27)
Orthology
K00457  
4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
ddc  Dickeya dadantii Ech586
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ddc00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:ddc00360]
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:ddc00130]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4806381..4807469)
Genome map
AA seq 362 aa AA seqDB search
MTNLLANPLNLNGFAFIEFVTDEPKALSTLFISLGFTCVAHHRHRAISLFRQNNINFLVN
NTATGFPRTFLQEHGAGACGMGFYVKDAHQAYEQALLSGAKPAEQAANPGEIQVPAIEGI
GGSKIYFIEKYHSDIDIFDIEFSFIPGVEKNPKGFGLHTIDHLTNNVYQGRMDYWSEFYS
QIFNFQQIRYFDIAGEYTGLHSKAMVAPDGKIRIPLNEEAEGSNGQIQEFLRRFNGEGIQ
HIAMQTDDILTTLDQLRQAGLPLMTAPSDTYYQMVEERLPGHSRDIAALQKRGILLDGNT
DNGQKKLLLQIFSETLIGPLFFEFIERDGDEGFGEGNFKALFESMERDQLARGEIKVTTE
AV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactaatttattagccaacccgctcaatttaaatggatttgcttttatcgaatttgtc
accgatgaaccaaaagcgctatcgacattattcatttcgctcgggtttacctgtgttgca
caccatcgccaccgcgccatttcgctgtttcgacaaaataatatcaacttccttgtgaat
aataccgccaccggttttccgcgaacctttctacaggaacacggtgccggggcctgcggt
atggggttttatgtcaaggatgcgcaccaagcgtatgaacaggcgctgttgtccggtgcc
aaaccggcagagcaggccgctaacccaggtgaaattcaggtaccggcgattgagggaatt
ggtggttcaaaaatctacttcatcgagaaatatcattcggatatcgatatctttgatatc
gaattttcatttattcccggtgttgaaaaaaatccgaaaggatttgggctgcacaccatt
gaccatctgactaataatgtctatcagggaagaatggattactggtctgaattctacagc
cagatatttaatttccagcaaattcgttattttgatattgcgggtgaatataccggtttg
cactcaaaagccatggtcgcaccagacggaaaaattcgtattccgctgaatgaagaagcg
gaaggcagtaatgggcaaatccaggagtttttgcgtcggtttaatggcgaagggatccaa
catatcgccatgcaaaccgatgatattctgacgacactcgatcaactgcgccaggctgga
ttaccgttaatgaccgcaccatccgatacctattaccagatggtggaagaacgcctgcca
ggccatagccgggatatcgccgcgctgcaaaaacgcggtattttgcttgatggcaacacc
gataacgggcagaaaaagctactgttgcagattttctcagaaaccctcatcggccctttg
ttttttgaattcatcgagcgggacggcgacgagggctttggcgaaggtaacttcaaagcg
ctgtttgaatccatggagcgcgaccaactggcgcgtggggaaatcaaagtcacgacagaa
gcggtctaa

DBGET integrated database retrieval system